(data stored in ACNUC16935 zone)

EMBL: BN001307.PE171

BN001307.PE171       Location/Qualifiers
FT   CDS             490992..491828
FT                   /locus_tag="ANIA_08908"
FT                   /old_locus_tag="AN8908.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007959"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007959"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007959"
FT                   /db_xref="GOA:Q5AS22"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="InterPro:IPR024078"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AS22"
FT                   /protein_id="CBF84686.1"
FT                   /translation="MKFPLPLPTLLGALTLLTPAFSANTLNIVAHPDDDLLFLNPDIQN
FT                   DISSGFNVRTVYLTSGDAGQPYEYWTLRQAGLLTAYAQMAGVESIWDESDAGVAGKDIP
FT                   VYTLRPKPEVSLAFMHIPDGSMDGNGFPATGQESLEKLWKGAIARIRTVDASGTTYSRG
FT                   ELVETLRQIIDSFVPDSLNSLDYVHPYGSGDHSDHTSAGLFTNTAAITSSFPGSVIAYR
FT                   GYPIKSEPANVGGEDLVRKKEVFYTYAAFDEDVCGSDQACAGKEYELWLPKQYTAN"
     MKFPLPLPTL LGALTLLTPA FSANTLNIVA HPDDDLLFLN PDIQNDISSG FNVRTVYLTS        60
     GDAGQPYEYW TLRQAGLLTA YAQMAGVESI WDESDAGVAG KDIPVYTLRP KPEVSLAFMH       120
     IPDGSMDGNG FPATGQESLE KLWKGAIARI RTVDASGTTY SRGELVETLR QIIDSFVPDS       180
     LNSLDYVHPY GSGDHSDHTS AGLFTNTAAI TSSFPGSVIA YRGYPIKSEP ANVGGEDLVR       240
     KKEVFYTYAA FDEDVCGSDQ ACAGKEYELW LPKQYTAN                               278
//

If you have problems or comments...

PBIL Back to PBIL home page