(data stored in ACNUC16935 zone)

EMBL: BN001307.PE173

BN001307.PE173       Location/Qualifiers
FT   CDS             complement(join(496668..496707,496823..497359,
FT                   497483..497625))
FT                   /locus_tag="ANIA_08906"
FT                   /old_locus_tag="AN8906.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007961"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007961"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007961"
FT                   /db_xref="InterPro:IPR031818"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AS24"
FT                   /protein_id="CBF84689.1"
FT                   /translation="MCSQTQTSHDPQPQSNMIKRLSARISLRWPPEPPFENTDTLVLSV
FT                   GNCMKDEVLFTHELDSRNAFGVADCGTFSALPNGDDLEVGVMPRPDLPGAPVREYEEVW
FT                   RELPFVRMEGHENVSFVLESATGGTQLKEGEEKEITRTFIGAIWGSFIALRQTQVLARP
FT                   IGETRTVIKSGAEVSAKREDFVQGQGFVVRYSLGPEADELPTHSDIQLPASDGSLEKLV
FT                   VCGQDLHPQGKDVTVKE"
     MCSQTQTSHD PQPQSNMIKR LSARISLRWP PEPPFENTDT LVLSVGNCMK DEVLFTHELD        60
     SRNAFGVADC GTFSALPNGD DLEVGVMPRP DLPGAPVREY EEVWRELPFV RMEGHENVSF       120
     VLESATGGTQ LKEGEEKEIT RTFIGAIWGS FIALRQTQVL ARPIGETRTV IKSGAEVSAK       180
     REDFVQGQGF VVRYSLGPEA DELPTHSDIQ LPASDGSLEK LVVCGQDLHP QGKDVTVKE        239
//

If you have problems or comments...

PBIL Back to PBIL home page