(data stored in ACNUC16935 zone)

EMBL: BN001307.PE175

BN001307.PE175       Location/Qualifiers
FT   CDS             complement(join(500484..500831,500894..501031,
FT                   501100..501558,501604..502076,502122..502401))
FT                   /locus_tag="ANIA_11149"
FT                   /old_locus_tag="AN11149.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007963"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007963"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007963"
FT                   /db_xref="GOA:C8VLL2"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR012083"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR024607"
FT                   /db_xref="UniProtKB/TrEMBL:C8VLL2"
FT                   /protein_id="CBF84693.1"
FT                   /translation="MKLSSLVALVGVSALSEASPRPKPNFVFVFTDDQDLTMNSVEYMP
FT                   HVAGRIRDRGLDFTNHFVTTALCCPSRVSLWTGRQAHNTNVTWVAPPYGGYPKFVSQGF
FT                   NEDWFPLWLQDAGYNTYYVGKLFNAHSVTTYNNPFVKGFNGSDFLLDPFTYSYWNSSYQ
FT                   RNHEAPKSYAGQYTTDVTEEKALGFVDDALEDKERPFFLTVAPIAPHFEQDPGHSSDTP
FT                   PQAPIPAPRHAHLFPDAKVPRVPSFNPLNQTGPSWIRDLKHQNQSVVDYEDFFYRQRLR
FT                   ALQSVDEMVDKLLDRLERSGQLNNTYVIYSSDNGFHIGHHRLPPGKSTSYEEDIRVPFF
FT                   IRGPGIKSGGKVTQVTTHIDFAPTIFELLGLPPRSDFDGTPMRIMKDSAAIPHEHVIVE
FT                   YWGQALMMVTAPTNTDRMPNTTYKSVRLLSEKYNLFYAVWCTGDHELFDLNTDPYQMHN
FT                   IYNTASRSFKNRLDALLLVLKSCAGSTCIKPWAELHPDGSVQSLSDALDSQYDGFYAQL
FT                   PKVEYEACVDGYLIAAEGLQWEDVSASALRNYVRRNYAFDDVQKYRKL"
     MKLSSLVALV GVSALSEASP RPKPNFVFVF TDDQDLTMNS VEYMPHVAGR IRDRGLDFTN        60
     HFVTTALCCP SRVSLWTGRQ AHNTNVTWVA PPYGGYPKFV SQGFNEDWFP LWLQDAGYNT       120
     YYVGKLFNAH SVTTYNNPFV KGFNGSDFLL DPFTYSYWNS SYQRNHEAPK SYAGQYTTDV       180
     TEEKALGFVD DALEDKERPF FLTVAPIAPH FEQDPGHSSD TPPQAPIPAP RHAHLFPDAK       240
     VPRVPSFNPL NQTGPSWIRD LKHQNQSVVD YEDFFYRQRL RALQSVDEMV DKLLDRLERS       300
     GQLNNTYVIY SSDNGFHIGH HRLPPGKSTS YEEDIRVPFF IRGPGIKSGG KVTQVTTHID       360
     FAPTIFELLG LPPRSDFDGT PMRIMKDSAA IPHEHVIVEY WGQALMMVTA PTNTDRMPNT       420
     TYKSVRLLSE KYNLFYAVWC TGDHELFDLN TDPYQMHNIY NTASRSFKNR LDALLLVLKS       480
     CAGSTCIKPW AELHPDGSVQ SLSDALDSQY DGFYAQLPKV EYEACVDGYL IAAEGLQWED       540
     VSASALRNYV RRNYAFDDVQ KYRKL                                             565
//

If you have problems or comments...

PBIL Back to PBIL home page