(data stored in ACNUC16935 zone)

EMBL: BN001307.PE177

BN001307.PE177       Location/Qualifiers
FT   CDS             join(507408..507726,507781..507900,507962..508574,
FT                   508625..509459)
FT                   /locus_tag="ANIA_08903"
FT                   /old_locus_tag="AN8903.4"
FT                   /product="MFS peptide transporter, putative
FT                   (AFU_orthologue; AFUA_8G02550)"
FT                   /note="transcript_id=CADANIAT00007965"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007965"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007965"
FT                   /db_xref="GOA:Q5AS27"
FT                   /db_xref="InterPro:IPR000109"
FT                   /db_xref="InterPro:IPR018456"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AS27"
FT                   /protein_id="CBF84697.1"
FT                   /translation="MNPADSVEIGDAVAAQQNAHLAQLPLGKDIKLEKDAIARESSIEE
FT                   IPATKEYPTGSEEDQDLNKLHPTQEEMQTLRRVAGPMNWITFSVAFVELCERFSYYGTT
FT                   AVFVNFIQQPLPPGSTTGAISGGSEVPGALDMGQQASTGLTLFNSFWSYVMPLAGAFLA
FT                   DQYWGRFRTIMFSIGCALVGHVILIISAIPPVIANPNGAIGCFAIGLIIMGMGTGGFKS
FT                   NISALIAEQYPDERPYLKTLPSGERIIIDPAATVARVYLYFYLCINVGSLTGQISMVYA
FT                   ERYVGFWLSFLLPTIMFCFSPLVLYLCRNKYHLVPPTGSVYTQAYRLIREAIRHHWSVT
FT                   TVKVAGIPFKRIKKNDTHFWNTVKPSTMGANRPTWMTFDDEWVDEVARGLKACRVFLWY
FT                   PLYWLAYNQMLNNLTSQAATMRLGGVPNDIINNFNPLALIIFIPIFDRLLYPFLRRIGI
FT                   KFTPLKRITAGFFVAGSGMIVATVTQHYIYKKGPCGKEANSCLEQGLHAPISVWVQALT
FT                   YILGGISEILASVTSLEYAFTKAPKNMRSLVQAVSLFMNAFSSAIGQAFVGLSEDPLLV
FT                   WNYAVVAILAFVGGIGFWATNYKLDKQEDELNTLAQSKYEGSGLKQDEEAKA"
     MNPADSVEIG DAVAAQQNAH LAQLPLGKDI KLEKDAIARE SSIEEIPATK EYPTGSEEDQ        60
     DLNKLHPTQE EMQTLRRVAG PMNWITFSVA FVELCERFSY YGTTAVFVNF IQQPLPPGST       120
     TGAISGGSEV PGALDMGQQA STGLTLFNSF WSYVMPLAGA FLADQYWGRF RTIMFSIGCA       180
     LVGHVILIIS AIPPVIANPN GAIGCFAIGL IIMGMGTGGF KSNISALIAE QYPDERPYLK       240
     TLPSGERIII DPAATVARVY LYFYLCINVG SLTGQISMVY AERYVGFWLS FLLPTIMFCF       300
     SPLVLYLCRN KYHLVPPTGS VYTQAYRLIR EAIRHHWSVT TVKVAGIPFK RIKKNDTHFW       360
     NTVKPSTMGA NRPTWMTFDD EWVDEVARGL KACRVFLWYP LYWLAYNQML NNLTSQAATM       420
     RLGGVPNDII NNFNPLALII FIPIFDRLLY PFLRRIGIKF TPLKRITAGF FVAGSGMIVA       480
     TVTQHYIYKK GPCGKEANSC LEQGLHAPIS VWVQALTYIL GGISEILASV TSLEYAFTKA       540
     PKNMRSLVQA VSLFMNAFSS AIGQAFVGLS EDPLLVWNYA VVAILAFVGG IGFWATNYKL       600
     DKQEDELNTL AQSKYEGSGL KQDEEAKA                                          628
//

If you have problems or comments...

PBIL Back to PBIL home page