(data stored in ACNUC16935 zone)

EMBL: BN001307.PE183

BN001307.PE183       Location/Qualifiers
FT   CDS             join(520116..520297,520353..521286)
FT                   /locus_tag="ANIA_08897"
FT                   /old_locus_tag="AN8897.4"
FT                   /product="lipase/thioesterase family protein
FT                   (AFU_orthologue; AFUA_8G02590)"
FT                   /note="transcript_id=CADANIAT00007971"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007971"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007971"
FT                   /db_xref="GOA:Q5AS33"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AS33"
FT                   /protein_id="CBF84708.1"
FT                   /translation="MLTIAQKLDYIPALASVAVTFVWALLTVAIRAPEYPSHWLLHVGY
FT                   AVFRKLTARLSAAQMQYVLPASNLVYNRYIRSVRQKPLTVQLEHGAMGHWIGDPKAKNI
FT                   LVWYHGTSRLLAHNPPGVLTEAGGGFALPANIGYFKFFASIVADCERNGQSLAVFALTY
FT                   TLAPVATYPTQLRQAVEALRYILVEKRHSADHVMLGGDSAGGNLVGGVLSHLSHTHPAI
FT                   DPLPLDGAALAGAVMIAPWTQLQPELGDRIIDSRGDLITPAVGPLWGSGYVGEAPKDFY
FT                   TDLSDAPVEWFAKFPVRKILVCGGEREILLPVIEDFVEKLRKGFKGDVEFCVGKGEGHV
FT                   APVYNLYIGDKRETQQGARAKSFIRGLLEKM"
     MLTIAQKLDY IPALASVAVT FVWALLTVAI RAPEYPSHWL LHVGYAVFRK LTARLSAAQM        60
     QYVLPASNLV YNRYIRSVRQ KPLTVQLEHG AMGHWIGDPK AKNILVWYHG TSRLLAHNPP       120
     GVLTEAGGGF ALPANIGYFK FFASIVADCE RNGQSLAVFA LTYTLAPVAT YPTQLRQAVE       180
     ALRYILVEKR HSADHVMLGG DSAGGNLVGG VLSHLSHTHP AIDPLPLDGA ALAGAVMIAP       240
     WTQLQPELGD RIIDSRGDLI TPAVGPLWGS GYVGEAPKDF YTDLSDAPVE WFAKFPVRKI       300
     LVCGGEREIL LPVIEDFVEK LRKGFKGDVE FCVGKGEGHV APVYNLYIGD KRETQQGARA       360
     KSFIRGLLEK M                                                            371
//

If you have problems or comments...

PBIL Back to PBIL home page