(data stored in ACNUC16935 zone)

EMBL: BN001307.PE186

BN001307.PE186       Location/Qualifiers
FT   CDS             join(525301..525447,525583..525819)
FT                   /locus_tag="ANIA_11150"
FT                   /old_locus_tag="AN11150.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007974"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007974"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007974"
FT                   /db_xref="UniProtKB/TrEMBL:C8VLS4"
FT                   /protein_id="CBF84713.1"
FT                   /translation="MKKGKRMKKTIIMKTALASLITAYVPAECTRPESMNERDPTRNLR
FT                   REAGSGPKNIPPRTENGWVHPRICSQPRRNDVQTAYGEQCDSGPDAIDKSVAGYPARGR
FT                   QQKSADKLFACLWGDVVLEAKVI"
     MKKGKRMKKT IIMKTALASL ITAYVPAECT RPESMNERDP TRNLRREAGS GPKNIPPRTE        60
     NGWVHPRICS QPRRNDVQTA YGEQCDSGPD AIDKSVAGYP ARGRQQKSAD KLFACLWGDV       120
     VLEAKVI                                                                 127
//

If you have problems or comments...

PBIL Back to PBIL home page