(data stored in ACNUC16935 zone)

EMBL: BN001307.PE188

BN001307.PE188       Location/Qualifiers
FT   CDS             join(530252..530444,530577..530635,530692..530752,
FT                   530799..531037)
FT                   /locus_tag="ANIA_08893"
FT                   /old_locus_tag="AN8893.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007976"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007976"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007976"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AS37"
FT                   /protein_id="CBF84717.1"
FT                   /translation="MTKIALFGSTGQICRAILLALLTTTPHEIASIDQPSSENKAKEID
FT                   VCEEEKKRLKTAGINILEAVGYGMHLLHTDENGRGVLHPTWNIKEDGNRKALHHPPISA
FT                   GQRASLVSLDPAGRAVYTLHILGDADAAVDFTHIDNLAAFVVFTIDSPDVAGNKSLNIV
FT                   SDRISYNELTTLLEKYSKKK"
     MTKIALFGST GQICRAILLA LLTTTPHEIA SIDQPSSENK AKEIDVCEEE KKRLKTAGIN        60
     ILEAVGYGMH LLHTDENGRG VLHPTWNIKE DGNRKALHHP PISAGQRASL VSLDPAGRAV       120
     YTLHILGDAD AAVDFTHIDN LAAFVVFTID SPDVAGNKSL NIVSDRISYN ELTTLLEKYS       180
     KKK                                                                     183
//

If you have problems or comments...

PBIL Back to PBIL home page