(data stored in ACNUC16935 zone)

EMBL: BN001307.PE193

BN001307.PE193       Location/Qualifiers
FT   CDS             547358..547777
FT                   /locus_tag="ANIA_08888"
FT                   /old_locus_tag="AN8888.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007981"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007981"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007981"
FT                   /db_xref="GOA:C8VLT1"
FT                   /db_xref="UniProtKB/TrEMBL:C8VLT1"
FT                   /protein_id="CBF84726.1"
FT                   /translation="MSYYNALIRTHHITSRKKVSALKRAADSLNVFALLRSGGCPGIMY
FT                   IEAKDKDAVESWVSVVRNLRYKDFQLVSRPACVVIEEDFMKVEGKQKNDAQRRGKAFLD
FT                   AGLEEVESVKEFGDLMAQRGVWQWWRKRMGYVRGD"
     MSYYNALIRT HHITSRKKVS ALKRAADSLN VFALLRSGGC PGIMYIEAKD KDAVESWVSV        60
     VRNLRYKDFQ LVSRPACVVI EEDFMKVEGK QKNDAQRRGK AFLDAGLEEV ESVKEFGDLM       120
     AQRGVWQWWR KRMGYVRGD                                                    139
//

If you have problems or comments...

PBIL Back to PBIL home page