(data stored in ACNUC16935 zone)

EMBL: BN001307.PE196

BN001307.PE196       Location/Qualifiers
FT   CDS             complement(join(551069..551320,551425..553587))
FT                   /locus_tag="ANIA_08886"
FT                   /old_locus_tag="AN8886.4"
FT                   /product="repressor protein (AFU_orthologue; AFUA_8G02700)"
FT                   /note="transcript_id=CADANIAT00007983"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007983"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007983"
FT                   /db_xref="GOA:Q5AS44"
FT                   /db_xref="InterPro:IPR001381"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AS44"
FT                   /protein_id="CBF84731.1"
FT                   /translation="MPHCSGADVYRRVDPEASLVLIGIRGCGKRSLGFVAATALKRRFI
FT                   TEDHYFKEVTGLSRHEYLKQHGSQNFQQRDIEVLKLMLDNHRSRCVIECGLGTLTRPVQ
FT                   EYLRQYSLTNPVVYIARDMDRIQKLLGFDDQAAKLLCEGDPLHRTCSNFEYYNAEDRSS
FT                   FAQLDEETQDRRSVVYSFKLKEAKEDFTRFVRFVTGTDVGHSSYDSPFVLLETPPELRS
FT                   YTYAIFVRSSDMIDNRVRLSELESGGDAIELCVDRWGPNMAMTVSKQVSILRRNTHAPI
FT                   ILSIDTRSLGITGGDQYPIKGSNVYAQIVEHCLRLAVEYLVVDLDQDQALINETIRNRG
FT                   MTKIIGQRIFEPSSGVSWDNEECLSAYLNAAGLGCQLVRILRVATEREDNAAIAKFTNR
FT                   IELLPGDHPPVIAFNLGSLGRTSQVFNSILTSVSHSAIDRLSHNERDPQIMARDAVQAL
FT                   FQSYVLDPLQFYILGGSVAYSLSPAMYNAAFRHCGMNHTYSIPEKPTLAALDELGRDPN
FT                   FGGASIVQPWRVQVFQKLAAKSRHAEAIGAINTIMPLRGHSDGTMFPLQEQASRRHLAG
FT                   PVLGWYGENTDWVGIMTCINRNLSPRNAISPSRTTGLVIGAGGMARAAIYAMLRLGCRK
FT                   IFIYNRTLSRAETVARHFNSWAASQVGSTEVVYVLRSLHEEWPQDACPPCMVASCVPAD
FT                   PDRDEPPANFEMPTQWLGSPTGGVVLEFAYKPLETPLLRQMRRFRSETGRQWELVDGLD
FT                   NVAEQAIAQFEILTGRKAPRRLMTMEALRNYAGENGPFDEKTIRARINIYE"
     MPHCSGADVY RRVDPEASLV LIGIRGCGKR SLGFVAATAL KRRFITEDHY FKEVTGLSRH        60
     EYLKQHGSQN FQQRDIEVLK LMLDNHRSRC VIECGLGTLT RPVQEYLRQY SLTNPVVYIA       120
     RDMDRIQKLL GFDDQAAKLL CEGDPLHRTC SNFEYYNAED RSSFAQLDEE TQDRRSVVYS       180
     FKLKEAKEDF TRFVRFVTGT DVGHSSYDSP FVLLETPPEL RSYTYAIFVR SSDMIDNRVR       240
     LSELESGGDA IELCVDRWGP NMAMTVSKQV SILRRNTHAP IILSIDTRSL GITGGDQYPI       300
     KGSNVYAQIV EHCLRLAVEY LVVDLDQDQA LINETIRNRG MTKIIGQRIF EPSSGVSWDN       360
     EECLSAYLNA AGLGCQLVRI LRVATEREDN AAIAKFTNRI ELLPGDHPPV IAFNLGSLGR       420
     TSQVFNSILT SVSHSAIDRL SHNERDPQIM ARDAVQALFQ SYVLDPLQFY ILGGSVAYSL       480
     SPAMYNAAFR HCGMNHTYSI PEKPTLAALD ELGRDPNFGG ASIVQPWRVQ VFQKLAAKSR       540
     HAEAIGAINT IMPLRGHSDG TMFPLQEQAS RRHLAGPVLG WYGENTDWVG IMTCINRNLS       600
     PRNAISPSRT TGLVIGAGGM ARAAIYAMLR LGCRKIFIYN RTLSRAETVA RHFNSWAASQ       660
     VGSTEVVYVL RSLHEEWPQD ACPPCMVASC VPADPDRDEP PANFEMPTQW LGSPTGGVVL       720
     EFAYKPLETP LLRQMRRFRS ETGRQWELVD GLDNVAEQAI AQFEILTGRK APRRLMTMEA       780
     LRNYAGENGP FDEKTIRARI NIYE                                              804
//

If you have problems or comments...

PBIL Back to PBIL home page