(data stored in ACNUC16935 zone)

EMBL: BN001307.PE198

BN001307.PE198       Location/Qualifiers
FT   CDS             complement(join(558286..558621,558677..559612))
FT                   /locus_tag="ANIA_11144"
FT                   /old_locus_tag="AN11144.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007985"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007985"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007985"
FT                   /db_xref="GOA:C8VLT5"
FT                   /db_xref="InterPro:IPR003378"
FT                   /db_xref="UniProtKB/TrEMBL:C8VLT5"
FT                   /protein_id="CBF84735.1"
FT                   /translation="MRKDWAFSDNSGATTDWQIKNVTNAPKYDNMTACAHLPGMDKVLV
FT                   ILKTGATEALDKIPVHLRTTLECVQHYVIFSDFEEYIYGVHVQDVLRSVSEGMKQTNSD
FT                   FGIYNRLRASGRGGLTADDWRDDENGPLGKQGNPGWKLDKWKFVPMIDEALLASPWAHW
FT                   YVFLEADTYIVWRNMVRWLSQLDQRKALYLGAPMQMGSQIFAYGGAGIVLSRTAMRLIS
FT                   QYRAQNFTVVEQMTADDWAGDHVLGRILGDIGVPLIWSWPLLVPSSIWEFEYFTKAYGR
FT                   QPWCYPAVSFHHMSTQDIWDMWLLEQQWFKYQVDVPLLHKDIFNWKLYDAISSMKDDWD
FT                   NISSDQQPRNISDSPTTSEECKQRCSLITDCLQFSFSHEGCRTSKKVVGGVPRPGFHSG
FT                   WVATRIKALIKNAGRCSKAQYITG"
     MRKDWAFSDN SGATTDWQIK NVTNAPKYDN MTACAHLPGM DKVLVILKTG ATEALDKIPV        60
     HLRTTLECVQ HYVIFSDFEE YIYGVHVQDV LRSVSEGMKQ TNSDFGIYNR LRASGRGGLT       120
     ADDWRDDENG PLGKQGNPGW KLDKWKFVPM IDEALLASPW AHWYVFLEAD TYIVWRNMVR       180
     WLSQLDQRKA LYLGAPMQMG SQIFAYGGAG IVLSRTAMRL ISQYRAQNFT VVEQMTADDW       240
     AGDHVLGRIL GDIGVPLIWS WPLLVPSSIW EFEYFTKAYG RQPWCYPAVS FHHMSTQDIW       300
     DMWLLEQQWF KYQVDVPLLH KDIFNWKLYD AISSMKDDWD NISSDQQPRN ISDSPTTSEE       360
     CKQRCSLITD CLQFSFSHEG CRTSKKVVGG VPRPGFHSGW VATRIKALIK NAGRCSKAQY       420
     ITG                                                                     423
//

If you have problems or comments...

PBIL Back to PBIL home page