(data stored in ACNUC16935 zone)

EMBL: BN001307.PE2

BN001307.PE2         Location/Qualifiers
FT   CDS             complement(join(4058..4094,4350..5323,5610..5684,
FT                   5717..5769,5842..6011,6229..6584))
FT                   /locus_tag="ANIA_09484"
FT                   /old_locus_tag="AN9484.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007794"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007794"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007794"
FT                   /db_xref="InterPro:IPR023374"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AQE6"
FT                   /protein_id="CBF84373.1"
FT                   /translation="MPRQHSCLKPRLGDIPFQVVTQRPSCRPCTSRRPLSQPEAWVIIR
FT                   VSLSGSPKAIEQDDDILDSVVERQPEMGGHFVARITDKDNAAKAPIRDDSLIQVRQAGP
FT                   QHPRPNILDRDLECQRGGFYHCLLWIVLQGNVVHDPTGPAVNAIGTNGKGPVEHAAVGA
FT                   GHTDYVLGGCDRAQPGESDWVSRLTGNDVGKEENKEQQLLCHPPRIRGLCAPSAFSRIP
FT                   ALYSITAAQTLPPTDENPISGYYISSFLTTTAGNQYYVITAIIGTTELGAYGINILDLN
FT                   TLQRVVYENTTVYSTTEITSFNFTREDFAFFGADSTNLAIAVRANATASRGDGTTVPVG
FT                   LELLVHATSRALYYGGTGSWMFIDTPAYSFAFPAAMTSGCLRMSLSDLSMANKEDADAA
FT                   TTLQPIDPSASVSWYDRSWGHLGLPNGNYTWFSLYLDDSELILVTYLIDDSSTSASSSR
FT                   THRHTHSRSIHIRPRRNSSALSLEPIDVFEPDLSPDTIWMSPRSGRVYPQQWKLGIEGR
FT                   GLLSIRSILGDQEMFGRGQGGESYSGLTQSPAEQPAG"
     MPRQHSCLKP RLGDIPFQVV TQRPSCRPCT SRRPLSQPEA WVIIRVSLSG SPKAIEQDDD        60
     ILDSVVERQP EMGGHFVARI TDKDNAAKAP IRDDSLIQVR QAGPQHPRPN ILDRDLECQR       120
     GGFYHCLLWI VLQGNVVHDP TGPAVNAIGT NGKGPVEHAA VGAGHTDYVL GGCDRAQPGE       180
     SDWVSRLTGN DVGKEENKEQ QLLCHPPRIR GLCAPSAFSR IPALYSITAA QTLPPTDENP       240
     ISGYYISSFL TTTAGNQYYV ITAIIGTTEL GAYGINILDL NTLQRVVYEN TTVYSTTEIT       300
     SFNFTREDFA FFGADSTNLA IAVRANATAS RGDGTTVPVG LELLVHATSR ALYYGGTGSW       360
     MFIDTPAYSF AFPAAMTSGC LRMSLSDLSM ANKEDADAAT TLQPIDPSAS VSWYDRSWGH       420
     LGLPNGNYTW FSLYLDDSEL ILVTYLIDDS STSASSSRTH RHTHSRSIHI RPRRNSSALS       480
     LEPIDVFEPD LSPDTIWMSP RSGRVYPQQW KLGIEGRGLL SIRSILGDQE MFGRGQGGES       540
     YSGLTQSPAE QPAG                                                         554
//

If you have problems or comments...

PBIL Back to PBIL home page