(data stored in ACNUC16935 zone)

EMBL: BN001307.PE20

BN001307.PE20        Location/Qualifiers
FT   CDS             complement(57704..58591)
FT                   /locus_tag="ANIA_09041"
FT                   /old_locus_tag="AN9041.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007811"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007811"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007811"
FT                   /db_xref="GOA:C8VKQ7"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:C8VKQ7"
FT                   /protein_id="CBF84406.1"
FT                   /translation="MDLTQIRRHHWTTSITYDASNIITYNLSVGSKGQDLRHCWEEHPE
FT                   FQALPTFSSLAVIDIMGKVTVDMPKLLPLYKPSQHPHVHAEHSLEIRGPLPRSGTLTSE
FT                   ARILDVVDRRTGVALIVGISIRNEDTGEWICYSEWTSFLMKMPGDGASKASSSMQSTLL
FT                   PSREPDAVLSHQTTPEQGALYRAATGEWNPMHIDPATAQRAGFPGPILSGTCTIGIGVN
FT                   HVIEAFAGGDSARFQRLKLRLSKPVFPGEVVTTKMWRFNETKIVYQQVAGDGRVVISNA
FT                   EIKLKAGGKQRSQL"
     MDLTQIRRHH WTTSITYDAS NIITYNLSVG SKGQDLRHCW EEHPEFQALP TFSSLAVIDI        60
     MGKVTVDMPK LLPLYKPSQH PHVHAEHSLE IRGPLPRSGT LTSEARILDV VDRRTGVALI       120
     VGISIRNEDT GEWICYSEWT SFLMKMPGDG ASKASSSMQS TLLPSREPDA VLSHQTTPEQ       180
     GALYRAATGE WNPMHIDPAT AQRAGFPGPI LSGTCTIGIG VNHVIEAFAG GDSARFQRLK       240
     LRLSKPVFPG EVVTTKMWRF NETKIVYQQV AGDGRVVISN AEIKLKAGGK QRSQL            295
//

If you have problems or comments...

PBIL Back to PBIL home page