(data stored in ACNUC16935 zone)

EMBL: BN001307.PE200

BN001307.PE200       Location/Qualifiers
FT   CDS             join(564859..564952,565122..565184,565294..565333,
FT                   565424..565478)
FT                   /locus_tag="ANIA_11633"
FT                   /old_locus_tag="AN11633.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007986"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007986"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007986"
FT                   /db_xref="GOA:C8VLT6"
FT                   /db_xref="UniProtKB/TrEMBL:C8VLT6"
FT                   /protein_id="CBF84738.1"
FT                   /translation="MLLYPPTFVLGRWSRPAAVLRTSGIHALTFERFLFPAIEGHWAYC
FT                   DSQNIAFPSREPYGLDSPDMKRWQQTYVISLDEIRQCD"
     MLLYPPTFVL GRWSRPAAVL RTSGIHALTF ERFLFPAIEG HWAYCDSQNI AFPSREPYGL        60
     DSPDMKRWQQ TYVISLDEIR QCD                                                83
//

If you have problems or comments...

PBIL Back to PBIL home page