(data stored in ACNUC16935 zone)

EMBL: BN001307.PE201

BN001307.PE201       Location/Qualifiers
FT   CDS             join(566404..566464,566530..566549,566685..566772,
FT                   566829..567250)
FT                   /locus_tag="ANIA_08883"
FT                   /old_locus_tag="AN8883.4"
FT                   /product="RNA binding protein Tma22, putative
FT                   (AFU_orthologue; AFUA_8G02730)"
FT                   /note="transcript_id=CADANIAT00007987"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007987"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007987"
FT                   /db_xref="GOA:C8VLT7"
FT                   /db_xref="InterPro:IPR001950"
FT                   /db_xref="InterPro:IPR036877"
FT                   /db_xref="UniProtKB/TrEMBL:C8VLT7"
FT                   /protein_id="CBF84739.1"
FT                   /translation="MAEVSQPPAETQARQITYCGVCTLPPEYCEFGGTAKKCQEWLKDN
FT                   RLEEYQRLYSDEAISANLSTLSVSVQERAAKDAAKKEAKAAAAEARDAERRATSKVQIK
FT                   RVERNKRKHVSVVTGLEVYGLENKKVAKELGKKFATGSSVTKSASGIEEITVQGDVCED
FT                   IKEWLLENYGKGISESNIEIVEDKKKKKGTAEA"
     MAEVSQPPAE TQARQITYCG VCTLPPEYCE FGGTAKKCQE WLKDNRLEEY QRLYSDEAIS        60
     ANLSTLSVSV QERAAKDAAK KEAKAAAAEA RDAERRATSK VQIKRVERNK RKHVSVVTGL       120
     EVYGLENKKV AKELGKKFAT GSSVTKSASG IEEITVQGDV CEDIKEWLLE NYGKGISESN       180
     IEIVEDKKKK KGTAEA                                                       196
//

If you have problems or comments...

PBIL Back to PBIL home page