(data stored in ACNUC16935 zone)

EMBL: BN001307.PE202

BN001307.PE202       Location/Qualifiers
FT   CDS             complement(join(567382..568099,568143..568426))
FT                   /locus_tag="ANIA_08882"
FT                   /old_locus_tag="AN8882.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007988"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007988"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007988"
FT                   /db_xref="GOA:C8VLT8"
FT                   /db_xref="UniProtKB/TrEMBL:C8VLT8"
FT                   /protein_id="CBF84741.1"
FT                   /translation="MHHVSSRADGRGSISTYQQQESEEDGMLRPSARENTQSRWGSVST
FT                   GLESRRDSVFYGIDKDIRLGSIKRPEEIHSMDDLQRVRDLRSRGEQYVILYLRSALSAV
FT                   GTLATDITRRLDYTYYGLLEKIAALTMTIVSLQELSDTTSKLFDDFQQETTGLEHDIRK
FT                   QIGDLHEFQPQVQRIEALEERMRASKTRAKALSNRLDAMRSEIERWDKREMEWQMRTNQ
FT                   RLRIFWGIITSVILAALVFIILQHWPSEETSSGFKALPRSLKLTNNPSHIPHPKENDAF
FT                   SPSSRSEYAMTLESSNLDGTTSTVQKDPSTSVGADKATRSADYDPLRIFDEL"
     MHHVSSRADG RGSISTYQQQ ESEEDGMLRP SARENTQSRW GSVSTGLESR RDSVFYGIDK        60
     DIRLGSIKRP EEIHSMDDLQ RVRDLRSRGE QYVILYLRSA LSAVGTLATD ITRRLDYTYY       120
     GLLEKIAALT MTIVSLQELS DTTSKLFDDF QQETTGLEHD IRKQIGDLHE FQPQVQRIEA       180
     LEERMRASKT RAKALSNRLD AMRSEIERWD KREMEWQMRT NQRLRIFWGI ITSVILAALV       240
     FIILQHWPSE ETSSGFKALP RSLKLTNNPS HIPHPKENDA FSPSSRSEYA MTLESSNLDG       300
     TTSTVQKDPS TSVGADKATR SADYDPLRIF DEL                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page