(data stored in ACNUC16935 zone)

EMBL: BN001307.PE203

BN001307.PE203       Location/Qualifiers
FT   CDS             complement(join(569467..569607,569678..569823,
FT                   569904..569961))
FT                   /locus_tag="ANIA_11145"
FT                   /old_locus_tag="AN11145.4"
FT                   /product="rRNA-processing protein cgrA
FT                   [Source:UniProtKB/Swiss-Prot;Acc:Q9Y708]"
FT                   /note="transcript_id=CADANIAT00007989"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007989"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007989"
FT                   /db_xref="GOA:Q9Y708"
FT                   /db_xref="InterPro:IPR005579"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Y708"
FT                   /protein_id="CBF84743.1"
FT                   /translation="MSSAAPAPSTHAAKSIRKNGKNWHDNKKPFRPNGGLTSYTKRAAA
FT                   RKEQEAIKEYEKELREEREAERQAHIQRIKERRAAKEEKERYEKMAEKMHRKRVERLKK
FT                   REKRNKLLNS"
     MSSAAPAPST HAAKSIRKNG KNWHDNKKPF RPNGGLTSYT KRAAARKEQE AIKEYEKELR        60
     EEREAERQAH IQRIKERRAA KEEKERYEKM AEKMHRKRVE RLKKREKRNK LLNS             114
//

If you have problems or comments...

PBIL Back to PBIL home page