(data stored in ACNUC16935 zone)

EMBL: BN001307.PE204

BN001307.PE204       Location/Qualifiers
FT   CDS             join(570534..570644,570699..571568)
FT                   /locus_tag="ANIA_08881"
FT                   /old_locus_tag="AN8881.4"
FT                   /product="Mitochondrial carrier AMCAPutative
FT                   uncharacterized protein ;
FT                   [Source:UniProtKB/TrEMBL;Acc:Q8X1Z8]"
FT                   /note="transcript_id=CADANIAT00007990"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007990"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007990"
FT                   /db_xref="GOA:G5EB14"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="InterPro:IPR023395"
FT                   /db_xref="InterPro:IPR040062"
FT                   /db_xref="UniProtKB/TrEMBL:G5EB14"
FT                   /protein_id="CBF84745.1"
FT                   /translation="MAATESALTIHNDISMELPELAPNQGLEAFKDIVFGSAAGMIGKV
FT                   IEYPFDTVKVRLQSQPDHLPLRYNGPLDCFRQSFQAEGLRGLYRGISAPMAGAAVENSC
FT                   LFFSYRVVQELLQASYYSSTEPLPLTALVFSGAASGSITSLALTPIELIKCKMQVPSEP
FT                   SSARVGPLKIIVSVFRQDGVLGFWRGQLGTLIRETGGGAAWFGGYEGVSALFRSYHYSP
FT                   STTFSSEVESGSLPLYQQMLAGAAAGVSYNFLFYPADTIKSRLQTEDINNTSSKRQTFG
FT                   GAARALWHQQGLRGLYRGCGITCARSAPSSAFIFTVFEGLRSYFG"
     MAATESALTI HNDISMELPE LAPNQGLEAF KDIVFGSAAG MIGKVIEYPF DTVKVRLQSQ        60
     PDHLPLRYNG PLDCFRQSFQ AEGLRGLYRG ISAPMAGAAV ENSCLFFSYR VVQELLQASY       120
     YSSTEPLPLT ALVFSGAASG SITSLALTPI ELIKCKMQVP SEPSSARVGP LKIIVSVFRQ       180
     DGVLGFWRGQ LGTLIRETGG GAAWFGGYEG VSALFRSYHY SPSTTFSSEV ESGSLPLYQQ       240
     MLAGAAAGVS YNFLFYPADT IKSRLQTEDI NNTSSKRQTF GGAARALWHQ QGLRGLYRGC       300
     GITCARSAPS SAFIFTVFEG LRSYFG                                            326
//

If you have problems or comments...

PBIL Back to PBIL home page