(data stored in ACNUC16935 zone)

EMBL: BN001307.PE206

BN001307.PE206       Location/Qualifiers
FT   CDS             complement(join(573136..573772,573824..577599))
FT                   /locus_tag="ANIA_08880"
FT                   /old_locus_tag="AN8880.4"
FT                   /product="vacuolar protein sorting protein, putative
FT                   (AFU_orthologue; AFUA_8G02780)"
FT                   /note="transcript_id=CADANIAT00007992"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007992"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007992"
FT                   /db_xref="GOA:Q5AS50"
FT                   /db_xref="InterPro:IPR006581"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR031777"
FT                   /db_xref="InterPro:IPR031778"
FT                   /db_xref="InterPro:IPR036278"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5AS50"
FT                   /protein_id="CBF84749.1"
FT                   /translation="MIPRWIQLVGCLLLALMLPPSAAKKDKPGISFHKLHEKPYSMFYF
FT                   EKSDTVLLNLEDGEVLRSFDAGENWEVIEDNGMKHGVTSIHQHPFDEDKAYALGDDGKH
FT                   WITTDKAKTWKSFKVPDQAYFKSPQTGPLTFHGRDSSKVIFETRPCPSCAPRSYYTTDD
FT                   FDTIEVLTESAVGCYWAVGNPQFAAGPNMPKGMEERTVCVVPGLKASSRFAFRLVYSDD
FT                   YFRSQGIETKLQDGRPVSGVTSIAQVKSFIVAAVESQGTTERALYVTTDIEKWHRAEFG
FT                   DHRLEQDAYTVLESSDYSLQVDVLTNPFSGMGVLFTSNSDGTYFTRNIEHTNRGPRGYV
FT                   DFEKLAAIQGIVLVNTVRNPDDVEAGASKEVVSQISFDDGRTFQPLKSTDGQRIHLHSV
FT                   NSDTNLGRVFSSPAPGLVMGVGNTGDYLGKRSDGHLYVSDDAGLTWRLALKGPHKYEFG
FT                   DQGAVLVAISEAPKVKKIEYSLDHGKEWKSVDLPHEVDGETSTLTTTPDSTSLKFILLG
FT                   HSKGEPSVYAIDFEDLHERKCEDEDFDNHWPARLDEHGEPDCLMGQKQFFRRRKANADC
FT                   FVAEAFNSSMSKFEPCKCTVEDFECQSTRTEDGKDCVPPKSFTPPDGDCINPDDTTMIP
FT                   SGWRLIPGDVCVRDDGVNLDKDVEIPCKDVNNRPKSKEITSTMKMFSSGLSAYRYLERQ
FT                   VSNLGEDETVLMLSRNQELFVSHDHGQTWQQELKGASIMKIVPHPYNSDTAYILTDSEE
FT                   VFYTINRGATFGSFRAKTLPDYENGPILRFHPLKRDWLLWVGTECDSGSCHSNAYFSDD
FT                   RGDSWKTILRHAKKCEFEYKENRPDSLYLVFCEQYENEDDKKRLQLMSTTDERFSDWET
FT                   VEENLVEYATRAEYIILASHTDKDNALKARVSVDGTTFADLKFPPNVVPAQNLYTLVDA
FT                   SEHAIFLYVGGSNNTGSLIKSNSNGTTYVLSLDAVNQNDWGYVDFERMQALEGVIIANI
FT                   VSNVDELSDGAPKRLRTMITHNDGGEWTLLAPPTKDANGKKFPCSVVEGKGTEDCALHL
FT                   HGYTERADPRDTFSSGSAIGLMMGLGNVGDRLTSKDEADTFLTMDGGITWKSVKKGRYM
FT                   WEYGDSGSVIVIVSEQKSTKVLHYSTDEGATWQDYYFSDEEIEVIDISTVPSDTSKKFI
FT                   LWGKKSDELVTVNVDFSGLYDRDCEFDDKGGDVSDDYQLWTPKHPFQEENCLFGHVEQY
FT                   RRKKPSAECWNNWRGPHLHSIQRNCTCTTADYECDYNYERQNDGTCKLVPGLKPHDPVG
FT                   YCKAHPDAIEYFEPTGYRRIPQTTCQGGYNLDHQTAKPCPGKQQEYDKKHGISGIGLFF
FT                   AIVAPIAVAGAVGYYIYTKWDGKFGQIRLGETSTGTQGILSRDSLLVTVPIAIIAGIVA
FT                   VAKALPLLVTSLWRSASGYMRVGNRSYPRPYASRASFAARRGDYSSVVEDEDELLGVVD
FT                   FDGDEEEDS"
     MIPRWIQLVG CLLLALMLPP SAAKKDKPGI SFHKLHEKPY SMFYFEKSDT VLLNLEDGEV        60
     LRSFDAGENW EVIEDNGMKH GVTSIHQHPF DEDKAYALGD DGKHWITTDK AKTWKSFKVP       120
     DQAYFKSPQT GPLTFHGRDS SKVIFETRPC PSCAPRSYYT TDDFDTIEVL TESAVGCYWA       180
     VGNPQFAAGP NMPKGMEERT VCVVPGLKAS SRFAFRLVYS DDYFRSQGIE TKLQDGRPVS       240
     GVTSIAQVKS FIVAAVESQG TTERALYVTT DIEKWHRAEF GDHRLEQDAY TVLESSDYSL       300
     QVDVLTNPFS GMGVLFTSNS DGTYFTRNIE HTNRGPRGYV DFEKLAAIQG IVLVNTVRNP       360
     DDVEAGASKE VVSQISFDDG RTFQPLKSTD GQRIHLHSVN SDTNLGRVFS SPAPGLVMGV       420
     GNTGDYLGKR SDGHLYVSDD AGLTWRLALK GPHKYEFGDQ GAVLVAISEA PKVKKIEYSL       480
     DHGKEWKSVD LPHEVDGETS TLTTTPDSTS LKFILLGHSK GEPSVYAIDF EDLHERKCED       540
     EDFDNHWPAR LDEHGEPDCL MGQKQFFRRR KANADCFVAE AFNSSMSKFE PCKCTVEDFE       600
     CQSTRTEDGK DCVPPKSFTP PDGDCINPDD TTMIPSGWRL IPGDVCVRDD GVNLDKDVEI       660
     PCKDVNNRPK SKEITSTMKM FSSGLSAYRY LERQVSNLGE DETVLMLSRN QELFVSHDHG       720
     QTWQQELKGA SIMKIVPHPY NSDTAYILTD SEEVFYTINR GATFGSFRAK TLPDYENGPI       780
     LRFHPLKRDW LLWVGTECDS GSCHSNAYFS DDRGDSWKTI LRHAKKCEFE YKENRPDSLY       840
     LVFCEQYENE DDKKRLQLMS TTDERFSDWE TVEENLVEYA TRAEYIILAS HTDKDNALKA       900
     RVSVDGTTFA DLKFPPNVVP AQNLYTLVDA SEHAIFLYVG GSNNTGSLIK SNSNGTTYVL       960
     SLDAVNQNDW GYVDFERMQA LEGVIIANIV SNVDELSDGA PKRLRTMITH NDGGEWTLLA      1020
     PPTKDANGKK FPCSVVEGKG TEDCALHLHG YTERADPRDT FSSGSAIGLM MGLGNVGDRL      1080
     TSKDEADTFL TMDGGITWKS VKKGRYMWEY GDSGSVIVIV SEQKSTKVLH YSTDEGATWQ      1140
     DYYFSDEEIE VIDISTVPSD TSKKFILWGK KSDELVTVNV DFSGLYDRDC EFDDKGGDVS      1200
     DDYQLWTPKH PFQEENCLFG HVEQYRRKKP SAECWNNWRG PHLHSIQRNC TCTTADYECD      1260
     YNYERQNDGT CKLVPGLKPH DPVGYCKAHP DAIEYFEPTG YRRIPQTTCQ GGYNLDHQTA      1320
     KPCPGKQQEY DKKHGISGIG LFFAIVAPIA VAGAVGYYIY TKWDGKFGQI RLGETSTGTQ      1380
     GILSRDSLLV TVPIAIIAGI VAVAKALPLL VTSLWRSASG YMRVGNRSYP RPYASRASFA      1440
     ARRGDYSSVV EDEDELLGVV DFDGDEEEDS                                       1470
//

If you have problems or comments...

PBIL Back to PBIL home page