(data stored in ACNUC16935 zone)

EMBL: BN001307.PE208

BN001307.PE208       Location/Qualifiers
FT   CDS             join(583152..583641,583689..584260)
FT                   /locus_tag="ANIA_08878"
FT                   /old_locus_tag="AN8878.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007994"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007994"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007994"
FT                   /db_xref="GOA:Q5AS52"
FT                   /db_xref="InterPro:IPR036424"
FT                   /db_xref="InterPro:IPR038887"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AS52"
FT                   /protein_id="CBF84753.1"
FT                   /translation="MVSRRDRELLRDNIRSRGAKLSATDRENIMKPYLPDPSELPRWPP
FT                   QRRRKLPRKTPIRTFIKSQIHLITYTFLHIFFGIAVRLVQTYHAVLDRILAIIYYHHRT
FT                   PELIRKDVKDLDRLPGHLSVILSLRKEDDALPILMDEVAELVSWSASAGIPVLSVYEKS
FT                   GLLKSCIPMLHQVITNKLSSYFGSLQQPTLQLFAPHHPIYKTRPAGDAAKNSLVVLLLS
FT                   ATDGQETLVDLTKTLAEMSQNGKLSPDDITMELVDAEISEITTQPSQDVAPTANDHKVS
FT                   KPLQVKPEPDLLLVFGPSLKLNGYPPWHIRLTEMYCTGVNSDGFTGYGDNVEYQGFLRG
FT                   LWHYAGAQMRFGR"
     MVSRRDRELL RDNIRSRGAK LSATDRENIM KPYLPDPSEL PRWPPQRRRK LPRKTPIRTF        60
     IKSQIHLITY TFLHIFFGIA VRLVQTYHAV LDRILAIIYY HHRTPELIRK DVKDLDRLPG       120
     HLSVILSLRK EDDALPILMD EVAELVSWSA SAGIPVLSVY EKSGLLKSCI PMLHQVITNK       180
     LSSYFGSLQQ PTLQLFAPHH PIYKTRPAGD AAKNSLVVLL LSATDGQETL VDLTKTLAEM       240
     SQNGKLSPDD ITMELVDAEI SEITTQPSQD VAPTANDHKV SKPLQVKPEP DLLLVFGPSL       300
     KLNGYPPWHI RLTEMYCTGV NSDGFTGYGD NVEYQGFLRG LWHYAGAQMR FGR              353
//

If you have problems or comments...

PBIL Back to PBIL home page