(data stored in ACNUC16935 zone)

EMBL: BN001307.PE209

BN001307.PE209       Location/Qualifiers
FT   CDS             join(585690..585953,586014..587414)
FT                   /locus_tag="ANIA_08877"
FT                   /old_locus_tag="AN8877.4"
FT                   /product="ELMO/CED-12 family protein (AFU_orthologue;
FT                   AFUA_8G02810)"
FT                   /note="transcript_id=CADANIAT00007995"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007995"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007995"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR006816"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR024574"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AS53"
FT                   /protein_id="CBF84754.1"
FT                   /translation="MDSNVSELVERLGSEEDAVRKMAVFKLQSSIGDPSFADVFIAEDG
FT                   LTRLRYLTLHATGNTLAYSLTSFARLLEVDKGWECVDHELVERVVELIVTHPLVNILRG
FT                   AMSILVSIVSHPSSVGRLSQNAVWGFRALKPAIAIYPQFLEMLVNRLSSADHALCANAL
FT                   QLINSLMRDSITNDSDHEWPKFIQKLQDLGVIKAVYSLMQGTALQDHAHPLIEFQSLTK
FT                   ILLRKWRDTALDLENPEHRRALKGIHLASSQEKGNETGADMRRSKKHSPEKWRRLGFES
FT                   ESPVAQFEDMGFLGMMDLADYVRNHQDEFQKMLLEQSTKPARQRCPIARASLSVTSILY
FT                   DHFEVDKCETEDSKTYLILESRSNLDKLFKPLLLHWTRLHVAGLHSFFRLWKSTSAELE
FT                   DYDKIVELVRILIESVVGGAARTKDVQDVEEDLMEFEYSRLRDLQMELLELTYEDAWGQ
FT                   HLRQVREELQHEAAQFVKEQRIRCLLQGAWFPNENISELEGESGSPKWRYVQLSHNRRI
FT                   LHFGDFESMEMNRLDLDVLPGKSEVPLQPAIFELLAN"
     MDSNVSELVE RLGSEEDAVR KMAVFKLQSS IGDPSFADVF IAEDGLTRLR YLTLHATGNT        60
     LAYSLTSFAR LLEVDKGWEC VDHELVERVV ELIVTHPLVN ILRGAMSILV SIVSHPSSVG       120
     RLSQNAVWGF RALKPAIAIY PQFLEMLVNR LSSADHALCA NALQLINSLM RDSITNDSDH       180
     EWPKFIQKLQ DLGVIKAVYS LMQGTALQDH AHPLIEFQSL TKILLRKWRD TALDLENPEH       240
     RRALKGIHLA SSQEKGNETG ADMRRSKKHS PEKWRRLGFE SESPVAQFED MGFLGMMDLA       300
     DYVRNHQDEF QKMLLEQSTK PARQRCPIAR ASLSVTSILY DHFEVDKCET EDSKTYLILE       360
     SRSNLDKLFK PLLLHWTRLH VAGLHSFFRL WKSTSAELED YDKIVELVRI LIESVVGGAA       420
     RTKDVQDVEE DLMEFEYSRL RDLQMELLEL TYEDAWGQHL RQVREELQHE AAQFVKEQRI       480
     RCLLQGAWFP NENISELEGE SGSPKWRYVQ LSHNRRILHF GDFESMEMNR LDLDVLPGKS       540
     EVPLQPAIFE LLAN                                                         554
//

If you have problems or comments...

PBIL Back to PBIL home page