(data stored in ACNUC16935 zone)

EMBL: BN001307.PE21

BN001307.PE21        Location/Qualifiers
FT   CDS             complement(58876..59415)
FT                   /locus_tag="ANIA_09040"
FT                   /old_locus_tag="AN9040.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007812"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007812"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007812"
FT                   /db_xref="GOA:Q5ARP0"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARP0"
FT                   /protein_id="CBF84408.1"
FT                   /translation="MWLTRGFSRITETLSSLFCRSHSQSHSCSQTRERTRSAFNEGELE
FT                   GESGWQTCRPRHLTERRLSGFQPPPTEEEYTSSFFHGWYLPYNVRGLSQVEPEPEPEPA
FT                   PEADVELEDLPRYEHPPAYTNRSPPAEAHEIGSNSRNESLDVTECRPAPGLSNEPDTMA
FT                   VTGQPDNAPNDRRGPT"
     MWLTRGFSRI TETLSSLFCR SHSQSHSCSQ TRERTRSAFN EGELEGESGW QTCRPRHLTE        60
     RRLSGFQPPP TEEEYTSSFF HGWYLPYNVR GLSQVEPEPE PEPAPEADVE LEDLPRYEHP       120
     PAYTNRSPPA EAHEIGSNSR NESLDVTECR PAPGLSNEPD TMAVTGQPDN APNDRRGPT        179
//

If you have problems or comments...

PBIL Back to PBIL home page