(data stored in ACNUC16935 zone)

EMBL: BN001307.PE210

BN001307.PE210       Location/Qualifiers
FT   CDS             join(588327..588827,588903..590702)
FT                   /locus_tag="ANIA_08876"
FT                   /old_locus_tag="AN8876.4"
FT                   /product="cell cycle checkpoint protein Rad17, putative
FT                   (AFU_orthologue; AFUA_8G02820)"
FT                   /note="transcript_id=CADANIAT00007996"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007996"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007996"
FT                   /db_xref="GOA:C8VLU6"
FT                   /db_xref="InterPro:IPR004582"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8VLU6"
FT                   /protein_id="CBF84756.1"
FT                   /translation="MRNHKTQQLSDTTVCGLLQSASEPNYSHRRWPNSQMPGSAGTADV
FT                   DDNEDSIEDDYDSYDDLFTQHFTDEKLSHLDGIKVAPRPQNRAISPIGNAKDQTAKNAK
FT                   HFFWKSVSPSNNELPNPTPSEKGALPWAQRYAPLNLDELAVHKRKVGDVERWLSDALEG
FT                   KTRKNLLILRGPAGSGKTTTISLLSKKLRFDVLEWKTPSTVTYSSKDYVSFGAQFDGFL
FT                   SRSHIFGSLTLDGHHSSQVPLNNDHASQRRVILIEEFPTMAARNTTVLASFRLSILRYL
FT                   SLNGPHGGNTYGREVRVPPIVMVVSETFSSTESSFNNLTTHQLLGRELYNHPDTTIIEF
FT                   NSIAPTFMHKALNLVLKKSSCQPCGNQTLTQSIIENISKIGDIRNAIASLEFICLGNGN
FT                   KGYWSDPTVKTRRTARTRMKNTAVGSEMREEIAQREASLGLFHAVGKIIYNKRSDASDA
FT                   EHVQLPSPPDHLRDHDRPTVSMVHVNELLDETGTDIQLFIGTLHENYVPSCNGSSFTEC
FT                   LEGCIGFLSDSDMLCYDRKDRSKFQAGLGIGTVKIETGGVDVLRQEEISYQVAARGLLF
FT                   SLPYPVRRQLSYARNIKQAGDSHKVFFPPVIRLVRQLQEISNQIDSWKDALLSSTVRPT
FT                   AVPMKDHTTREFISGKGKSLQGNRDEESPSLVAMLSRSDLILHQLPYLTKIVGKGTMSK
FT                   NLQQSTGFGAGGSDFTSQHDEDYDFEPSFCEAPGPKSRLEKRIGLSEPQTTLSSQTTDE
FT                   RLVLSDDDIIDDL"
     MRNHKTQQLS DTTVCGLLQS ASEPNYSHRR WPNSQMPGSA GTADVDDNED SIEDDYDSYD        60
     DLFTQHFTDE KLSHLDGIKV APRPQNRAIS PIGNAKDQTA KNAKHFFWKS VSPSNNELPN       120
     PTPSEKGALP WAQRYAPLNL DELAVHKRKV GDVERWLSDA LEGKTRKNLL ILRGPAGSGK       180
     TTTISLLSKK LRFDVLEWKT PSTVTYSSKD YVSFGAQFDG FLSRSHIFGS LTLDGHHSSQ       240
     VPLNNDHASQ RRVILIEEFP TMAARNTTVL ASFRLSILRY LSLNGPHGGN TYGREVRVPP       300
     IVMVVSETFS STESSFNNLT THQLLGRELY NHPDTTIIEF NSIAPTFMHK ALNLVLKKSS       360
     CQPCGNQTLT QSIIENISKI GDIRNAIASL EFICLGNGNK GYWSDPTVKT RRTARTRMKN       420
     TAVGSEMREE IAQREASLGL FHAVGKIIYN KRSDASDAEH VQLPSPPDHL RDHDRPTVSM       480
     VHVNELLDET GTDIQLFIGT LHENYVPSCN GSSFTECLEG CIGFLSDSDM LCYDRKDRSK       540
     FQAGLGIGTV KIETGGVDVL RQEEISYQVA ARGLLFSLPY PVRRQLSYAR NIKQAGDSHK       600
     VFFPPVIRLV RQLQEISNQI DSWKDALLSS TVRPTAVPMK DHTTREFISG KGKSLQGNRD       660
     EESPSLVAML SRSDLILHQL PYLTKIVGKG TMSKNLQQST GFGAGGSDFT SQHDEDYDFE       720
     PSFCEAPGPK SRLEKRIGLS EPQTTLSSQT TDERLVLSDD DIIDDL                      766
//

If you have problems or comments...

PBIL Back to PBIL home page