(data stored in ACNUC16935 zone)

EMBL: BN001307.PE213

BN001307.PE213       Location/Qualifiers
FT   CDS             complement(join(597787..597873,597970..598239))
FT                   /locus_tag="ANIA_11147"
FT                   /old_locus_tag="AN11147.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007999"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007999"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007999"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR035718"
FT                   /db_xref="InterPro:IPR036028"
FT                   /db_xref="UniProtKB/TrEMBL:C8VLU9"
FT                   /protein_id="CBF84762.1"
FT                   /translation="MVDKDWWLGSNAQGERGLFPSNYVELLEDGRQSRAESDTRPADAH
FT                   ESEALADPTPTSGSHVKPTAKALYDYEAAEDNELSFPEGAEIINIEFPDDDWWLGEFRG
FT                   KTGLFPANYVQLDD"
     MVDKDWWLGS NAQGERGLFP SNYVELLEDG RQSRAESDTR PADAHESEAL ADPTPTSGSH        60
     VKPTAKALYD YEAAEDNELS FPEGAEIINI EFPDDDWWLG EFRGKTGLFP ANYVQLDD         118
//

If you have problems or comments...

PBIL Back to PBIL home page