(data stored in ACNUC16935 zone)

EMBL: BN001307.PE214

BN001307.PE214       Location/Qualifiers
FT   CDS             complement(join(598550..598593,598716..599814,
FT                   599877..600064,600186..600399,600651..600758))
FT                   /locus_tag="ANIA_11139"
FT                   /old_locus_tag="AN11139.4"
FT                   /product="actin binding protein (Eurofung)"
FT                   /note="transcript_id=CADANIAT00008000"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008000"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008000"
FT                   /db_xref="GOA:C8VLV0"
FT                   /db_xref="InterPro:IPR002108"
FT                   /db_xref="InterPro:IPR029006"
FT                   /db_xref="UniProtKB/TrEMBL:C8VLV0"
FT                   /protein_id="CBF84764.1"
FT                   /translation="MTNAFGKALRHWVSPRSGQLNRATVWTSVTYFQTDSFEQIQTLET
FT                   CSTSVFFTEEDLDCQHGISQPIGQWTFDIEELSVSGRLCNNGFCKEFFNIRQMGIVLCF
FT                   NAPEGELADLIDEFSEGKIQFAFVKVIDTNTGLPKSVLIAWCGEGVPERTKGYFTSHLS
FT                   TVSKFLHGYHVQITARSEADLTVEGIIQKVGDASGAKYTQGLEKPNASVPKPPVSSKPV
FT                   FTPLRTGGINVNAAAAAPLPLRAKKNDDDGWGPDAPPVTRTNLEKVEPAYKPTRVNIQE
FT                   LKSEKQNEPTVNPSLTTGHQPDGVIKGGYQPIGKVDIAAIRRQAREAGNLTDDRPEPVK
FT                   GAYQPVGKVDIAAIRARAQKPDETDTSSKGSSARPDGSSGPTTDLDSTESSRLTSLPKP
FT                   KVTNKFASSTSFTGTKPPLPGGNALSATPVPPIGSASRTFADQGGKTPAQLWAEKKAKE
FT                   RSQEPAAAEESTKPAVANNVQSQLSGVREWKSSYTGRTWAPVQTTHTGKSVENNRTEVA
FT                   GSFATGMPTPEAITAQQSEATSSAATCPADPNT"
     MTNAFGKALR HWVSPRSGQL NRATVWTSVT YFQTDSFEQI QTLETCSTSV FFTEEDLDCQ        60
     HGISQPIGQW TFDIEELSVS GRLCNNGFCK EFFNIRQMGI VLCFNAPEGE LADLIDEFSE       120
     GKIQFAFVKV IDTNTGLPKS VLIAWCGEGV PERTKGYFTS HLSTVSKFLH GYHVQITARS       180
     EADLTVEGII QKVGDASGAK YTQGLEKPNA SVPKPPVSSK PVFTPLRTGG INVNAAAAAP       240
     LPLRAKKNDD DGWGPDAPPV TRTNLEKVEP AYKPTRVNIQ ELKSEKQNEP TVNPSLTTGH       300
     QPDGVIKGGY QPIGKVDIAA IRRQAREAGN LTDDRPEPVK GAYQPVGKVD IAAIRARAQK       360
     PDETDTSSKG SSARPDGSSG PTTDLDSTES SRLTSLPKPK VTNKFASSTS FTGTKPPLPG       420
     GNALSATPVP PIGSASRTFA DQGGKTPAQL WAEKKAKERS QEPAAAEEST KPAVANNVQS       480
     QLSGVREWKS SYTGRTWAPV QTTHTGKSVE NNRTEVAGSF ATGMPTPEAI TAQQSEATSS       540
     AATCPADPNT                                                              550
//

If you have problems or comments...

PBIL Back to PBIL home page