(data stored in ACNUC16935 zone)

EMBL: BN001307.PE216

BN001307.PE216       Location/Qualifiers
FT   CDS             complement(604191..606008)
FT                   /locus_tag="ANIA_08871"
FT                   /old_locus_tag="AN8871.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008002"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008002"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008002"
FT                   /db_xref="GOA:C8VLV2"
FT                   /db_xref="UniProtKB/TrEMBL:C8VLV2"
FT                   /protein_id="CBF84767.1"
FT                   /translation="MSQAASTTSRKPRRFLPEPIETSSRSSKNRQDNELTTQCLHQMQT
FT                   SFRTSEIRSTSCKNEDSGRSSHPPPQQTCLSPCLTTDHDAHRFTATMHKTPFTQVIGGN
FT                   QQGNAKRYTPQLMETVRHSFRPGKKPAKLFSSAGLGTQSSRDAIEAANRMEADHGAVQE
FT                   SRFSYSSLLRRQETRRHSFRVPDLPAIPSSGSDESNESDSPQVSSETIATARGTFSDDT
FT                   ARPRNGREMSFIEYILPFPRHPSENQLKEQALAAFPNEQVYQQVDHFAIDRDEEEPVNE
FT                   DIIKIRDPELEFRTRRRASSADLPSELEYLRKHKEEAGMNRRHYFTTRGACFSTCAVYQ
FT                   TSRKSGKPANHDDGWDPNSPFARLRQAASPPMLGGDLIFPQSLTPKTTICEHPNSVGSQ
FT                   GHRDHSLGSGLWSACPCSSAQYDIGGLWNGTCKSDRYSTHGVENLSREAITPKKDVINN
FT                   NSGNLDASSKASNLRHRKRQNAVQSPTNESADSERIDQEFNDDFVTQIYDYLSLGYPSI
FT                   ARYFDHELSRVSGLPIAALRADDLNMDAKGYVGVNDITNKGVANRVCMRWTALKLYIHE
FT                   WARQHPRMLEAGHYHETWGVSERKGSWAV"
     MSQAASTTSR KPRRFLPEPI ETSSRSSKNR QDNELTTQCL HQMQTSFRTS EIRSTSCKNE        60
     DSGRSSHPPP QQTCLSPCLT TDHDAHRFTA TMHKTPFTQV IGGNQQGNAK RYTPQLMETV       120
     RHSFRPGKKP AKLFSSAGLG TQSSRDAIEA ANRMEADHGA VQESRFSYSS LLRRQETRRH       180
     SFRVPDLPAI PSSGSDESNE SDSPQVSSET IATARGTFSD DTARPRNGRE MSFIEYILPF       240
     PRHPSENQLK EQALAAFPNE QVYQQVDHFA IDRDEEEPVN EDIIKIRDPE LEFRTRRRAS       300
     SADLPSELEY LRKHKEEAGM NRRHYFTTRG ACFSTCAVYQ TSRKSGKPAN HDDGWDPNSP       360
     FARLRQAASP PMLGGDLIFP QSLTPKTTIC EHPNSVGSQG HRDHSLGSGL WSACPCSSAQ       420
     YDIGGLWNGT CKSDRYSTHG VENLSREAIT PKKDVINNNS GNLDASSKAS NLRHRKRQNA       480
     VQSPTNESAD SERIDQEFND DFVTQIYDYL SLGYPSIARY FDHELSRVSG LPIAALRADD       540
     LNMDAKGYVG VNDITNKGVA NRVCMRWTAL KLYIHEWARQ HPRMLEAGHY HETWGVSERK       600
     GSWAV                                                                   605
//

If you have problems or comments...

PBIL Back to PBIL home page