(data stored in ACNUC16935 zone)

EMBL: BN001307.PE218

BN001307.PE218       Location/Qualifiers
FT   CDS             complement(join(616737..617101,617301..617403))
FT                   /locus_tag="ANIA_09418"
FT                   /old_locus_tag="AN9418.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008004"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008004"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008004"
FT                   /db_xref="GOA:Q5AQL2"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AQL2"
FT                   /protein_id="CBF84771.1"
FT                   /translation="MAQRSDVAVHGRKRPAEEELDDQPLTKKFGRLQIEQELAETEILD
FT                   GAFTILPGIEDRLSLTNILVANDSKRPCTDVVLYREPESLSIPKDKDQVRRALIETRER
FT                   ARLSQQKLRSSPGQEKNDAACTDQNLTHKEECQQRANSDDDDAMDIDVDGY"
     MAQRSDVAVH GRKRPAEEEL DDQPLTKKFG RLQIEQELAE TEILDGAFTI LPGIEDRLSL        60
     TNILVANDSK RPCTDVVLYR EPESLSIPKD KDQVRRALIE TRERARLSQQ KLRSSPGQEK       120
     NDAACTDQNL THKEECQQRA NSDDDDAMDI DVDGY                                  155
//

If you have problems or comments...

PBIL Back to PBIL home page