(data stored in ACNUC16935 zone)

EMBL: BN001307.PE22

BN001307.PE22        Location/Qualifiers
FT   CDS             complement(join(60985..62287,62339..62376))
FT                   /locus_tag="ANIA_11161"
FT                   /old_locus_tag="AN11161.4"
FT                   /product="phosphatidylserine decarboxylase family protein
FT                   (AFU_orthologue; AFUA_7G01730)"
FT                   /note="transcript_id=CADANIAT00007813"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007813"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007813"
FT                   /db_xref="GOA:C8VKQ9"
FT                   /db_xref="InterPro:IPR003817"
FT                   /db_xref="InterPro:IPR022237"
FT                   /db_xref="UniProtKB/TrEMBL:C8VKQ9"
FT                   /protein_id="CBF84410.1"
FT                   /translation="MPSHSSNTHRYHRVGHWMPSGYDDHHKWLGGVIAHVDSKQDKELH
FT                   PVLKEFQHLIETNTRVYMLISAMFAEVPKNRHYCKDPTGCSQIRDYHHMLQVLNHLITT
FT                   APSWNDFSLEVGLVGLPINAVLDWSMGTPSGYAAYLDPDINAMLKKVLNAWGEYLTSED
FT                   SAKVLGDDEYGWFGETGKNNLMHVANLPLGTDHEFDKLFVCDPSAKYHGYKSWDDFFTR
FT                   TFRPGVRSVASPDDDTVIVNACESQPYKVARGVKARDTFWIKGQPYSVADMLSHDPVTP
FT                   QFEGGTVYQAFLSALSYHRWHAPVSGKIVRAYVVDGTYYSEPLFEGLWDEEENKPKEQG
FT                   IDPGGEVTTQEYLTCVATRAIILIECDNPAIGLMAFLGVGMCEVSTCDITVKEGEHVRK
FT                   GDQLGMFHFGGSTHCLLFRKGVDVEGLPSPDLGRNVAVNSQLGVVKA"
     MPSHSSNTHR YHRVGHWMPS GYDDHHKWLG GVIAHVDSKQ DKELHPVLKE FQHLIETNTR        60
     VYMLISAMFA EVPKNRHYCK DPTGCSQIRD YHHMLQVLNH LITTAPSWND FSLEVGLVGL       120
     PINAVLDWSM GTPSGYAAYL DPDINAMLKK VLNAWGEYLT SEDSAKVLGD DEYGWFGETG       180
     KNNLMHVANL PLGTDHEFDK LFVCDPSAKY HGYKSWDDFF TRTFRPGVRS VASPDDDTVI       240
     VNACESQPYK VARGVKARDT FWIKGQPYSV ADMLSHDPVT PQFEGGTVYQ AFLSALSYHR       300
     WHAPVSGKIV RAYVVDGTYY SEPLFEGLWD EEENKPKEQG IDPGGEVTTQ EYLTCVATRA       360
     IILIECDNPA IGLMAFLGVG MCEVSTCDIT VKEGEHVRKG DQLGMFHFGG STHCLLFRKG       420
     VDVEGLPSPD LGRNVAVNSQ LGVVKA                                            446
//

If you have problems or comments...

PBIL Back to PBIL home page