(data stored in ACNUC16935 zone)

EMBL: BN001307.PE221

BN001307.PE221       Location/Qualifiers
FT   CDS             join(622409..622542,622599..623700)
FT                   /locus_tag="ANIA_09421"
FT                   /old_locus_tag="AN9421.4"
FT                   /product="RING finger domain protein, putative
FT                   (AFU_orthologue; AFUA_8G03900)"
FT                   /note="transcript_id=CADANIAT00008007"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008007"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008007"
FT                   /db_xref="GOA:Q5AQK9"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AQK9"
FT                   /protein_id="CBF84777.1"
FT                   /translation="MSSTTSSSPAPTDNGSGDNGGSSPTSSPLLFFVALGFGVVFTNLW
FT                   IIVGVKYCFRYNQRNRQIRGGDNGEPIDLVAMPRTHRRRREKKLMTMDEVNERFPLTKY
FT                   KVWRSSRANAGLSTAGGITAAHTENALDAEDDQQSLPEGATSLVTAPDAKSHQRLNSAT
FT                   SQQPTKPVDDGDMAPESEEKSIKGFSRTNNASPRVSSDRINPVVRDHDYHTVEDIIPTT
FT                   VLTDLDTSPGDSCAICLDLIEDDDDIRGLSCGHAFHASCVDPWLTSRRASCPLCKADYY
FT                   TPKPRPDASDLPSTSGRRAASPNHPQAVLIRGRVNPFRAQTLYGQASQSAPDTVSGTSR
FT                   PIGHRLWAVRTTPTIEEGRSRNDTSIPRLSSWLSNFSNRFRVRNQDSTTVPGNSHLNAP
FT                   RTPSQLEAGQTR"
     MSSTTSSSPA PTDNGSGDNG GSSPTSSPLL FFVALGFGVV FTNLWIIVGV KYCFRYNQRN        60
     RQIRGGDNGE PIDLVAMPRT HRRRREKKLM TMDEVNERFP LTKYKVWRSS RANAGLSTAG       120
     GITAAHTENA LDAEDDQQSL PEGATSLVTA PDAKSHQRLN SATSQQPTKP VDDGDMAPES       180
     EEKSIKGFSR TNNASPRVSS DRINPVVRDH DYHTVEDIIP TTVLTDLDTS PGDSCAICLD       240
     LIEDDDDIRG LSCGHAFHAS CVDPWLTSRR ASCPLCKADY YTPKPRPDAS DLPSTSGRRA       300
     ASPNHPQAVL IRGRVNPFRA QTLYGQASQS APDTVSGTSR PIGHRLWAVR TTPTIEEGRS       360
     RNDTSIPRLS SWLSNFSNRF RVRNQDSTTV PGNSHLNAPR TPSQLEAGQT R                411
//

If you have problems or comments...

PBIL Back to PBIL home page