(data stored in ACNUC16935 zone)

EMBL: BN001307.PE222

BN001307.PE222       Location/Qualifiers
FT   CDS             complement(join(624283..624849,624916..625047,
FT                   625116..625276,625335..625659))
FT                   /locus_tag="ANIA_09422"
FT                   /old_locus_tag="AN9422.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008008"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008008"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008008"
FT                   /db_xref="GOA:Q5AQK8"
FT                   /db_xref="InterPro:IPR024382"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AQK8"
FT                   /protein_id="CBF84779.1"
FT                   /translation="MRSVFSFLTTIGAISVGATALEASVITFGSVTQKQGLKSPDISSA
FT                   TLLQLLELRTKSPTTSSLQSSDEENLEFLNRLAGPPTRLFGAPAADGGLDTLLVVLEGL
FT                   TDEIGRSIQAEYQDELLITEFVTGSAEDTFLDYILEARLEGIVSPESKRCSLTSDSNEG
FT                   FVMSCLPANFNLTLGSGFLGQITSGESWIDNRKELVVMHIAFKGSTAYINDLKAFLSGL
FT                   RSLSLNGRRVTAVALPDLNASQKLSRTRRAPEHTALDTTFSWDRDERLMIADQHAQASL
FT                   SLGPVCYASNSSCNDATDTCSGHGACYEKSGGCYACLCHDTYVKTASGTERKIRWGGSA
FT                   CQKRDISSPFFLIMGVTVAVLLAVISAIAMIFGIGNDELPGVISAGVGTVRAQK"
     MRSVFSFLTT IGAISVGATA LEASVITFGS VTQKQGLKSP DISSATLLQL LELRTKSPTT        60
     SSLQSSDEEN LEFLNRLAGP PTRLFGAPAA DGGLDTLLVV LEGLTDEIGR SIQAEYQDEL       120
     LITEFVTGSA EDTFLDYILE ARLEGIVSPE SKRCSLTSDS NEGFVMSCLP ANFNLTLGSG       180
     FLGQITSGES WIDNRKELVV MHIAFKGSTA YINDLKAFLS GLRSLSLNGR RVTAVALPDL       240
     NASQKLSRTR RAPEHTALDT TFSWDRDERL MIADQHAQAS LSLGPVCYAS NSSCNDATDT       300
     CSGHGACYEK SGGCYACLCH DTYVKTASGT ERKIRWGGSA CQKRDISSPF FLIMGVTVAV       360
     LLAVISAIAM IFGIGNDELP GVISAGVGTV RAQK                                   394
//

If you have problems or comments...

PBIL Back to PBIL home page