(data stored in ACNUC16935 zone)

EMBL: BN001307.PE223

BN001307.PE223       Location/Qualifiers
FT   CDS             join(626156..626280,626334..626623,627022..627425)
FT                   /locus_tag="ANIA_09423"
FT                   /old_locus_tag="AN9423.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008009"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008009"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008009"
FT                   /db_xref="GOA:C8VLV9"
FT                   /db_xref="UniProtKB/TrEMBL:C8VLV9"
FT                   /protein_id="CBF84780.1"
FT                   /translation="MPPSRPLLYSHQSVLQIHPSRRYFSHGPNVRYVKVIKRPWSRGFI
FT                   ANILLCGIAAYFWSSFVPARKDNTSSNTASQTTVDSHSAPETTSRDRIEAVFIPTGWSH
FT                   LEEGRLYAATDPEWKEFVKISQSPEKLQSLKGNLLSERACLSDSYMDFKTLDKLGGASQ
FT                   SESPSTHLQPSSILATLRWLPLPKLGPGSDLHDATQVFKKRIDECQRSDSRAYRQGIFF
FT                   IRGPVGLKGSQGSCRIQVEGEYDPVASQWVSVSMHLNDLAFLSQKPLGRK"
     MPPSRPLLYS HQSVLQIHPS RRYFSHGPNV RYVKVIKRPW SRGFIANILL CGIAAYFWSS        60
     FVPARKDNTS SNTASQTTVD SHSAPETTSR DRIEAVFIPT GWSHLEEGRL YAATDPEWKE       120
     FVKISQSPEK LQSLKGNLLS ERACLSDSYM DFKTLDKLGG ASQSESPSTH LQPSSILATL       180
     RWLPLPKLGP GSDLHDATQV FKKRIDECQR SDSRAYRQGI FFIRGPVGLK GSQGSCRIQV       240
     EGEYDPVASQ WVSVSMHLND LAFLSQKPLG RK                                     272
//

If you have problems or comments...

PBIL Back to PBIL home page