(data stored in ACNUC16935 zone)

EMBL: BN001307.PE224

BN001307.PE224       Location/Qualifiers
FT   CDS             complement(join(628850..628982,629107..629165,
FT                   629213..629357,629403..629506))
FT                   /locus_tag="ANIA_09424"
FT                   /old_locus_tag="AN9424.4"
FT                   /product="cell cycle regulatory protein Cks/Suc1, putative
FT                   (AFU_orthologue; AFUA_8G03920)"
FT                   /note="transcript_id=CADANIAT00008010"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008010"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008010"
FT                   /db_xref="GOA:Q5AQK6"
FT                   /db_xref="InterPro:IPR000789"
FT                   /db_xref="InterPro:IPR036858"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AQK6"
FT                   /protein_id="CBF84782.1"
FT                   /translation="MDIDPSRRNKKPRPLLESERERLDEFIDSIHYSARYSDDQFEYRH
FT                   VQLPKNMLKKIPADYFDSSKGTLKLLWEEEWRALGITQSLGWEHYEVHEPEPHILLFNV
FT                   YTGVDSPDTEEEPSRRAAIQCTLECSRQFKTPCNEFDKWNMV"
     MDIDPSRRNK KPRPLLESER ERLDEFIDSI HYSARYSDDQ FEYRHVQLPK NMLKKIPADY        60
     FDSSKGTLKL LWEEEWRALG ITQSLGWEHY EVHEPEPHIL LFNVYTGVDS PDTEEEPSRR       120
     AAIQCTLECS RQFKTPCNEF DKWNMV                                            146
//

If you have problems or comments...

PBIL Back to PBIL home page