(data stored in ACNUC16935 zone)

EMBL: BN001307.PE225

BN001307.PE225       Location/Qualifiers
FT   CDS             join(630498..630540,630593..630643,630696..630822,
FT                   630872..631037,631090..631323,631386..631442,
FT                   631509..631949)
FT                   /locus_tag="ANIA_11227"
FT                   /old_locus_tag="AN11227.4"
FT                   /product="heat shock 70 kDa protein (Eurofung)"
FT                   /note="transcript_id=CADANIAT00008011"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008011"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008011"
FT                   /db_xref="GOA:C8VLW1"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="UniProtKB/TrEMBL:C8VLW1"
FT                   /protein_id="CBF84784.1"
FT                   /translation="MSDEVYEGAIGIDLGTTYSCVANYEGTNVEIIANEQGSYTTPSFV
FT                   SFTDKERLIGEAAKNQAAMNPQNTIFDIKRLIGRRYEDPIVKKDVESWPFKVVDQGGNP
FT                   AVEVEYLGETKTFTPQEISSMVLMKMKEVAETKLGKKVEKAVITVPAYFNDNQRQATKD
FT                   AGAIAGLNVLRIINEPTAAAIAYGLGSGKSEKERNVLIYDLGGGTFDVSLLNIQGGVFT
FT                   VKATAGDTHLGGQDFDTNLLEHFKKEFQKKTGKDLSGDSRALRRLRTACERAKRTLSNA
FT                   TQTSVEIDSLFDGEDFNTSITRARFEDLNAKSFSGTLEPVQQVLKDSGLAKNQVDEIVL
FT                   VGGSTRIPRIQKLLSDFFDGKKLEKVSFLCHC"
     MSDEVYEGAI GIDLGTTYSC VANYEGTNVE IIANEQGSYT TPSFVSFTDK ERLIGEAAKN        60
     QAAMNPQNTI FDIKRLIGRR YEDPIVKKDV ESWPFKVVDQ GGNPAVEVEY LGETKTFTPQ       120
     EISSMVLMKM KEVAETKLGK KVEKAVITVP AYFNDNQRQA TKDAGAIAGL NVLRIINEPT       180
     AAAIAYGLGS GKSEKERNVL IYDLGGGTFD VSLLNIQGGV FTVKATAGDT HLGGQDFDTN       240
     LLEHFKKEFQ KKTGKDLSGD SRALRRLRTA CERAKRTLSN ATQTSVEIDS LFDGEDFNTS       300
     ITRARFEDLN AKSFSGTLEP VQQVLKDSGL AKNQVDEIVL VGGSTRIPRI QKLLSDFFDG       360
     KKLEKVSFLC HC                                                           372
//

If you have problems or comments...

PBIL Back to PBIL home page