(data stored in ACNUC16935 zone)

EMBL: BN001307.PE226

BN001307.PE226       Location/Qualifiers
FT   CDS             join(631503..631925,631975..632455,632506..632774)
FT                   /locus_tag="ANIA_10202"
FT                   /old_locus_tag="AN10202.4"
FT                   /product="Heat shock protein 70
FT                   [Source:UniProtKB/TrEMBL;Acc:O42808]"
FT                   /note="transcript_id=CADANIAT00008012"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008012"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008012"
FT                   /db_xref="GOA:C8VLW2"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/TrEMBL:C8VLW2"
FT                   /protein_id="CBF84786.1"
FT                   /translation="MQAGDTHLGGQDFDTNLLEHFKKEFQKKTGKDLSGDSRALRRLRT
FT                   ACERAKRTLSNATQTSVEIDSLFDGEDFNTSITRARFEDLNAKSFSGTLEPVQQVLKDS
FT                   GLAKNQVDEIVLVGGSTRIPRIQKLLSDFFDGKKLEKSINPDEAVAYGAAVQAGILSGK
FT                   ATSAETQDLLLLDVVPLSLGVAMEGNIFAPVVPRGQTVPTIKKRTFTTVVDNQTTVQFP
FT                   VYQGERTNCADNTSLGEFTLAPIPPMRAGEAALECVFEVDVNGILKVTATEKSSGRSAN
FT                   ITISNAVGKLSTTEIEQMIDDAAKFKTSDEAFTKRFESRQQLESYISRVEEIISDPTMS
FT                   MKLKRGNREKIESALSDAMAQLEIEDSTPEDLKKKELALKRLITKAMATR"
     MQAGDTHLGG QDFDTNLLEH FKKEFQKKTG KDLSGDSRAL RRLRTACERA KRTLSNATQT        60
     SVEIDSLFDG EDFNTSITRA RFEDLNAKSF SGTLEPVQQV LKDSGLAKNQ VDEIVLVGGS       120
     TRIPRIQKLL SDFFDGKKLE KSINPDEAVA YGAAVQAGIL SGKATSAETQ DLLLLDVVPL       180
     SLGVAMEGNI FAPVVPRGQT VPTIKKRTFT TVVDNQTTVQ FPVYQGERTN CADNTSLGEF       240
     TLAPIPPMRA GEAALECVFE VDVNGILKVT ATEKSSGRSA NITISNAVGK LSTTEIEQMI       300
     DDAAKFKTSD EAFTKRFESR QQLESYISRV EEIISDPTMS MKLKRGNREK IESALSDAMA       360
     QLEIEDSTPE DLKKKELALK RLITKAMATR                                        390
//

If you have problems or comments...

PBIL Back to PBIL home page