(data stored in ACNUC16935 zone)

EMBL: BN001307.PE228

BN001307.PE228       Location/Qualifiers
FT   CDS             complement(join(634143..635053,635166..635286))
FT                   /locus_tag="ANIA_01405"
FT                   /old_locus_tag="AN1405.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008014"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008014"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008014"
FT                   /db_xref="GOA:Q5BDH5"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BDH5"
FT                   /protein_id="CBF84789.1"
FT                   /translation="MLQSRAMILHPWRLRRVVPSFSSIRQLSTSGALGADSSPADESKL
FT                   RVSTATPRKNEPKKLKIPPVLLKLNNSNVDRLRPRRIIDARSLAASKSSGGLPTNVLRG
FT                   PRRLGAQGGTSLRGRKPFNAKPAPRAPRRARQRDSAGEDENPSLTAELEDVYRELAEKT
FT                   KPTATRYEPQAPSLQSLSETWPSLPTDVTATAAGVAEKLSLLSERYPNGYVPPYTLGKR
FT                   LIEGKYVRFTSEAERIEALEAAKKFAQEAADKLSQEKGELIEPQAVKFQGAKGGEYKTL
FT                   IESLAQGKYPTVETVSTDKPPVVGEILRNIRNNESYQAPGKKAQFMAKLETLLVPNRAV
FT                   KRP"
     MLQSRAMILH PWRLRRVVPS FSSIRQLSTS GALGADSSPA DESKLRVSTA TPRKNEPKKL        60
     KIPPVLLKLN NSNVDRLRPR RIIDARSLAA SKSSGGLPTN VLRGPRRLGA QGGTSLRGRK       120
     PFNAKPAPRA PRRARQRDSA GEDENPSLTA ELEDVYRELA EKTKPTATRY EPQAPSLQSL       180
     SETWPSLPTD VTATAAGVAE KLSLLSERYP NGYVPPYTLG KRLIEGKYVR FTSEAERIEA       240
     LEAAKKFAQE AADKLSQEKG ELIEPQAVKF QGAKGGEYKT LIESLAQGKY PTVETVSTDK       300
     PPVVGEILRN IRNNESYQAP GKKAQFMAKL ETLLVPNRAV KRP                         343
//

If you have problems or comments...

PBIL Back to PBIL home page