(data stored in ACNUC16935 zone)

EMBL: BN001307.PE229

BN001307.PE229       Location/Qualifiers
FT   CDS             635453..635680
FT                   /locus_tag="ANIA_10206"
FT                   /old_locus_tag="AN10206.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008015"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008015"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008015"
FT                   /db_xref="GOA:C8VLW5"
FT                   /db_xref="InterPro:IPR018860"
FT                   /db_xref="UniProtKB/TrEMBL:C8VLW5"
FT                   /protein_id="CBF84791.1"
FT                   /translation="MIRRKPTAIAITSDDLTMFEEERLRKLEPRNSGHDPAQNGTRVNF
FT                   DPSDELKPLPGDKARIVRSREERIGIGQRS"
     MIRRKPTAIA ITSDDLTMFE EERLRKLEPR NSGHDPAQNG TRVNFDPSDE LKPLPGDKAR        60
     IVRSREERIG IGQRS                                                         75
//

If you have problems or comments...

PBIL Back to PBIL home page