(data stored in ACNUC16935 zone)

EMBL: BN001307.PE23

BN001307.PE23        Location/Qualifiers
FT   CDS             complement(join(62473..63050,63097..63161,63211..63602,
FT                   63693..63800,63846..64007))
FT                   /locus_tag="ANIA_11159"
FT                   /old_locus_tag="AN11159.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007814"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007814"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007814"
FT                   /db_xref="GOA:C8VKR0"
FT                   /db_xref="UniProtKB/TrEMBL:C8VKR0"
FT                   /protein_id="CBF84412.1"
FT                   /translation="MYETLPLVGHSLAIFVVAAVMVGFSIVAVFLRCFVRVYLVRAFGW
FT                   DDALMLTALALFIALCALCMLAPAAGVGHKVSDFMSLDQLQRALKLWWLGQMLYLWASA
FT                   VAKIAIALALLRLAVRRLHRFILWTICAVVVVIGLVFWLVLLFDCWPVEYFWEQTDIRK
FT                   QGKCISTEILLIIAYCYSSLTIVCDIMLGILPACLIWSLQMSRRTKLALVGVLSLGAIA
FT                   SVAVVIRLPYLENYADPDFLYSTYQIAIWSVVETGLAIIAGSLITLRPLFRWFLDGSSS
FT                   YKHQHTPQQKTNKKYVLSTLTANASMPGIEDPKYWRPDLGEDPHTVVTSIMAPLGRSMD
FT                   DNSTVALSPILPPPRKISVCVHQTFAVYKDPSSPVASSFGCPGQCSPAPVPASIQSATP
FT                   SLIPTPAPAQAPRLDNGRRYNRGYGAGYAGYTYEF"
     MYETLPLVGH SLAIFVVAAV MVGFSIVAVF LRCFVRVYLV RAFGWDDALM LTALALFIAL        60
     CALCMLAPAA GVGHKVSDFM SLDQLQRALK LWWLGQMLYL WASAVAKIAI ALALLRLAVR       120
     RLHRFILWTI CAVVVVIGLV FWLVLLFDCW PVEYFWEQTD IRKQGKCIST EILLIIAYCY       180
     SSLTIVCDIM LGILPACLIW SLQMSRRTKL ALVGVLSLGA IASVAVVIRL PYLENYADPD       240
     FLYSTYQIAI WSVVETGLAI IAGSLITLRP LFRWFLDGSS SYKHQHTPQQ KTNKKYVLST       300
     LTANASMPGI EDPKYWRPDL GEDPHTVVTS IMAPLGRSMD DNSTVALSPI LPPPRKISVC       360
     VHQTFAVYKD PSSPVASSFG CPGQCSPAPV PASIQSATPS LIPTPAPAQA PRLDNGRRYN       420
     RGYGAGYAGY TYEF                                                         434
//

If you have problems or comments...

PBIL Back to PBIL home page