(data stored in ACNUC16935 zone)

EMBL: BN001307.PE231

BN001307.PE231       Location/Qualifiers
FT   CDS             join(641167..641398,641447..641820)
FT                   /locus_tag="ANIA_01407"
FT                   /old_locus_tag="AN1407.4"
FT                   /product="cytoplasmic protein required for cell viability,
FT                   putative (AFU_orthologue; AFUA_8G03980)"
FT                   /note="transcript_id=CADANIAT00008017"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008017"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008017"
FT                   /db_xref="GOA:Q5BDH3"
FT                   /db_xref="InterPro:IPR002744"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="InterPro:IPR039796"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BDH3"
FT                   /protein_id="CBF84795.1"
FT                   /translation="MASEMQNSNPTIINTADLPTRLRPSASPKSSTYGSEFFASALPSL
FT                   TVDALSDYSPSTSESENDDDLMEEPIDEQEIYDLVSTISDPEHPISLGALAVVSLPDIS
FT                   IKPALPDVPDSPLRTVTVLITPTITHCSLATVIGLGVRVRLEQSLPPRFRVNVQIKEGT
FT                   HSTADEVNKQLADKERVAAALENGTLMGVIAKMLETCL"
     MASEMQNSNP TIINTADLPT RLRPSASPKS STYGSEFFAS ALPSLTVDAL SDYSPSTSES        60
     ENDDDLMEEP IDEQEIYDLV STISDPEHPI SLGALAVVSL PDISIKPALP DVPDSPLRTV       120
     TVLITPTITH CSLATVIGLG VRVRLEQSLP PRFRVNVQIK EGTHSTADEV NKQLADKERV       180
     AAALENGTLM GVIAKMLETC L                                                 201
//

If you have problems or comments...

PBIL Back to PBIL home page