(data stored in ACNUC16935 zone)

EMBL: BN001307.PE235

BN001307.PE235       Location/Qualifiers
FT   CDS             complement(649156..650757)
FT                   /locus_tag="ANIA_10190"
FT                   /old_locus_tag="AN10190.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008021"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008021"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008021"
FT                   /db_xref="GOA:C8VM23"
FT                   /db_xref="InterPro:IPR018791"
FT                   /db_xref="UniProtKB/TrEMBL:C8VM23"
FT                   /protein_id="CBF84802.1"
FT                   /translation="MSCDICTRTQASAFLCATCARNRLYQLRFDSASVILEREYLGQQI
FT                   EAAINADNEHEKCLSGRGNNSAELEEGRPRLWTIQRIKNEQSRSAARIEIVANHIKSLQ
FT                   SRIKDKSLDISQRKIKLTRQRSDSESALYQLSERESGMLSGIQNIIKRTDHLWHANHTK
FT                   TAEARIFLCREAASLYGLRQNVRKNNNGMKETYTIGGVGILDLREMNGKSLPYSGVKQF
FT                   VNTHTGAAPDHISTSFSYIAHILVLVSNYLSLRLPAEITLPHKDYPLPTIYTPSASYLP
FT                   QELRAVPFSDQLPSSRPTSRTALAHASFPRPRPLCIDKSLPKLAKEDPGTYALFIEGVT
FT                   LLAWNVSWLCRSQGLNLGSDSWEDVCDIGKNLWQLLVAPPGQSSALIATRKGSYQTRAH
FT                   KDFPRTMIQRTKSFPMLGHYSHGTAHSFLGASEGTEFVRNWKLPSPTKVVDGLKSTLLG
FT                   EMASAEWELLEENEWDDSRQPVSHESSHGSDLPHDDQSSYTSDTITLAPKLGAPDAPAI
FT                   AARSKGTSGWTKLRHR"
     MSCDICTRTQ ASAFLCATCA RNRLYQLRFD SASVILEREY LGQQIEAAIN ADNEHEKCLS        60
     GRGNNSAELE EGRPRLWTIQ RIKNEQSRSA ARIEIVANHI KSLQSRIKDK SLDISQRKIK       120
     LTRQRSDSES ALYQLSERES GMLSGIQNII KRTDHLWHAN HTKTAEARIF LCREAASLYG       180
     LRQNVRKNNN GMKETYTIGG VGILDLREMN GKSLPYSGVK QFVNTHTGAA PDHISTSFSY       240
     IAHILVLVSN YLSLRLPAEI TLPHKDYPLP TIYTPSASYL PQELRAVPFS DQLPSSRPTS       300
     RTALAHASFP RPRPLCIDKS LPKLAKEDPG TYALFIEGVT LLAWNVSWLC RSQGLNLGSD       360
     SWEDVCDIGK NLWQLLVAPP GQSSALIATR KGSYQTRAHK DFPRTMIQRT KSFPMLGHYS       420
     HGTAHSFLGA SEGTEFVRNW KLPSPTKVVD GLKSTLLGEM ASAEWELLEE NEWDDSRQPV       480
     SHESSHGSDL PHDDQSSYTS DTITLAPKLG APDAPAIAAR SKGTSGWTKL RHR              533
//

If you have problems or comments...

PBIL Back to PBIL home page