(data stored in ACNUC16935 zone)

EMBL: BN001307.PE236

BN001307.PE236       Location/Qualifiers
FT   CDS             join(651511..651744,651820..651878,651910..651974,
FT                   652025..652089)
FT                   /locus_tag="ANIA_01411"
FT                   /old_locus_tag="AN1411.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008022"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008022"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008022"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BDG9"
FT                   /protein_id="CBF84804.1"
FT                   /translation="MASGDKTPSRLPGPKSGIARSKPMLREQSVTSGDEESQLKDSIKD
FT                   FDWSQLESVYIQMMEQHEKSEEELRNHITRLLQTTVVHDESRAVKRLVVSFRRFRTQMH
FT                   HVQNSEESLEKKRRHYMDVVNAFERALALLNDRAKP"
     MASGDKTPSR LPGPKSGIAR SKPMLREQSV TSGDEESQLK DSIKDFDWSQ LESVYIQMME        60
     QHEKSEEELR NHITRLLQTT VVHDESRAVK RLVVSFRRFR TQMHHVQNSE ESLEKKRRHY       120
     MDVVNAFERA LALLNDRAKP                                                   140
//

If you have problems or comments...

PBIL Back to PBIL home page