(data stored in ACNUC16935 zone)

EMBL: BN001307.PE238

BN001307.PE238       Location/Qualifiers
FT   CDS             join(654515..656420,656492..656751,656797..656964,
FT                   657012..657341,657389..657584,657690..657765,
FT                   657811..658264,658309..658456,658508..658989)
FT                   /locus_tag="ANIA_01413"
FT                   /old_locus_tag="AN1413.4"
FT                   /product="Protein cft1 (Cleavage factor two protein 1)
FT                   [Source:UniProtKB/Swiss-Prot;Acc:Q5BDG7]"
FT                   /note="transcript_id=CADANIAT00008024"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008024"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008024"
FT                   /db_xref="GOA:Q5BDG7"
FT                   /db_xref="InterPro:IPR004871"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5BDG7"
FT                   /protein_id="CBF84808.1"
FT                   /translation="MQCYTELISPTGVTHALAVPFLSATANNLIVARTSLLQIFSLRDV
FT                   SLSALDTEVRPAQHRQETCKLVLEREYQLPGTVTDICRVKILKTKSGGDAVLVAFRDAK
FT                   LSLVEWDPERYGLSTISIHYYERDDMTRSPWASDLSTCGSILSADPGSRCAIFQFGARS
FT                   LAIIPFHQPGDDLVMDDFGSEPDYENRVEGNSRSHEAKDKDAAEYQTPYASSFVLPLTA
FT                   LDPSVIHPISLAFLYEYREPTFGILYSQVATSHALLHERKDVVFYTVITLDLEQRASTT
FT                   LLSVTRLPSDLFKVVALPPPVGGSLLIGSNELVHIDQAGKTNAVGVNEFSRQASSFSMT
FT                   DQSDLALRLENCVVERFSDDNGDLLLALSTGVFALVSFKLDGRSVSGISVRPLSGPSKE
FT                   FLASTASSSAFLGNGKVFFGSESADSVLLGWSSASSATKKSFSGSTSNDESEDDAYEDD
FT                   LYSSAPAAMTDNPQNQPSNSSVAAFGDLRIHDRLSSPGPIRDIVLGRSSEASSRDTKDG
FT                   VLELVAAQGSDEGGTMVIMKREVDPYLVASMAADTANSLWTVSLLPDNNDQKRDYVILS
FT                   KQEKPDKEESEVFVLEDKLRPITAPEFNPNHELTVEIGTLASKSRVIQVLRNEVRSYDA
FT                   VWDEDDSDERVAVNATLVDPYLAIIRDDSTLLLLQADDSGDLDEVTLSEDVVSQKWLSA
FT                   CFYSDNAGFFTAPFASILFLLNQDHQLYVYRLPDFAVISVIEGVGCLPPILSTEPPKRS
FT                   TTRENVLQIAVVELGDSYSSLPFLILRTENDDLVVYKPFFTNSKELTGLRFLKEANHTL
FT                   PKTPNTTDELQSEMKPLRILPNIAGCSSIFMPGPSAGFIFRASTTSPHFIRLRGGFIKG
FT                   LGCFDSPDKGFAYLDSHGLHLAKLPEGTQLGYPWIMRTVPIGQQIDKLTYVSASDTYVL
FT                   GTCQRCEFRLPEDDELHPEWRNEEISFLPEVNQSSLKVVSPKTWSVIDSYPLEPAEHIM
FT                   VMKTMSLEVSENTHERRDMIVVGTSLARGEDIPSRGCIYVFEVIEVVPDPEQPETNRRL
FT                   KLIGKEPVKGAVTALSEIGGQGFLIAAQGQKSMVRGLKEDGSLLPVAFMDMQCFVSVIK
FT                   ELKGTGMCIFGDAVKGLWFAGYSEEPYKMSLFAKDLDYLEVLAADFLPDGNKLFIVVAD
FT                   SDCNLYVLQYDPEDPNSSNGDKLLNRSKFHTGNFASTVTLLPRTLVSSERAMSGSDKMD
FT                   IDNTAPLHQVLVTSHNGSIGLVTCVPEESYRRLSALQSQLTNTLEHPCGLNPRAYRAVE
FT                   SDASAGRGMLDSNLLLQYLDMSKQRKAEIAGRVGATEWEIRADLEAISGGGLGYL"
     MQCYTELISP TGVTHALAVP FLSATANNLI VARTSLLQIF SLRDVSLSAL DTEVRPAQHR        60
     QETCKLVLER EYQLPGTVTD ICRVKILKTK SGGDAVLVAF RDAKLSLVEW DPERYGLSTI       120
     SIHYYERDDM TRSPWASDLS TCGSILSADP GSRCAIFQFG ARSLAIIPFH QPGDDLVMDD       180
     FGSEPDYENR VEGNSRSHEA KDKDAAEYQT PYASSFVLPL TALDPSVIHP ISLAFLYEYR       240
     EPTFGILYSQ VATSHALLHE RKDVVFYTVI TLDLEQRAST TLLSVTRLPS DLFKVVALPP       300
     PVGGSLLIGS NELVHIDQAG KTNAVGVNEF SRQASSFSMT DQSDLALRLE NCVVERFSDD       360
     NGDLLLALST GVFALVSFKL DGRSVSGISV RPLSGPSKEF LASTASSSAF LGNGKVFFGS       420
     ESADSVLLGW SSASSATKKS FSGSTSNDES EDDAYEDDLY SSAPAAMTDN PQNQPSNSSV       480
     AAFGDLRIHD RLSSPGPIRD IVLGRSSEAS SRDTKDGVLE LVAAQGSDEG GTMVIMKREV       540
     DPYLVASMAA DTANSLWTVS LLPDNNDQKR DYVILSKQEK PDKEESEVFV LEDKLRPITA       600
     PEFNPNHELT VEIGTLASKS RVIQVLRNEV RSYDAVWDED DSDERVAVNA TLVDPYLAII       660
     RDDSTLLLLQ ADDSGDLDEV TLSEDVVSQK WLSACFYSDN AGFFTAPFAS ILFLLNQDHQ       720
     LYVYRLPDFA VISVIEGVGC LPPILSTEPP KRSTTRENVL QIAVVELGDS YSSLPFLILR       780
     TENDDLVVYK PFFTNSKELT GLRFLKEANH TLPKTPNTTD ELQSEMKPLR ILPNIAGCSS       840
     IFMPGPSAGF IFRASTTSPH FIRLRGGFIK GLGCFDSPDK GFAYLDSHGL HLAKLPEGTQ       900
     LGYPWIMRTV PIGQQIDKLT YVSASDTYVL GTCQRCEFRL PEDDELHPEW RNEEISFLPE       960
     VNQSSLKVVS PKTWSVIDSY PLEPAEHIMV MKTMSLEVSE NTHERRDMIV VGTSLARGED      1020
     IPSRGCIYVF EVIEVVPDPE QPETNRRLKL IGKEPVKGAV TALSEIGGQG FLIAAQGQKS      1080
     MVRGLKEDGS LLPVAFMDMQ CFVSVIKELK GTGMCIFGDA VKGLWFAGYS EEPYKMSLFA      1140
     KDLDYLEVLA ADFLPDGNKL FIVVADSDCN LYVLQYDPED PNSSNGDKLL NRSKFHTGNF      1200
     ASTVTLLPRT LVSSERAMSG SDKMDIDNTA PLHQVLVTSH NGSIGLVTCV PEESYRRLSA      1260
     LQSQLTNTLE HPCGLNPRAY RAVESDASAG RGMLDSNLLL QYLDMSKQRK AEIAGRVGAT      1320
     EWEIRADLEA ISGGGLGYL                                                   1339
//

If you have problems or comments...

PBIL Back to PBIL home page