(data stored in ACNUC16935 zone)

EMBL: BN001307.PE239

BN001307.PE239       Location/Qualifiers
FT   CDS             complement(join(659824..659898,659955..661500,
FT                   661559..661704))
FT                   /locus_tag="ANIA_01414"
FT                   /old_locus_tag="AN1414.4"
FT                   /product="Protein pacG (Nonrepressible acid phosphatase
FT                   regulator pacG) [Source:UniProtKB/Swiss-Prot;Acc:Q05534]"
FT                   /note="transcript_id=CADANIAT00008025"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008025"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008025"
FT                   /db_xref="GOA:Q05534"
FT                   /db_xref="InterPro:IPR008967"
FT                   /db_xref="InterPro:IPR024061"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q05534"
FT                   /protein_id="CBF84810.1"
FT                   /translation="MEGFDTMALPYLASPLSLGNMQGTDYLNALQGMDLPDQRSNFDSE
FT                   TFVSGDDLTFAHLSPQTLKRFSSGYEDSFPEMVTSFDPPPPAEPPADSSIDHNNKLLSF
FT                   SMPVYPWTLLDYSFRRASISISAQLHGMFFLAESPWTTSPTENAPPQQGAELTCYRRNL
FT                   FQITGSVTLPRALRYIITDTGDRIPIVAHELTVSATESVEGNSVKIISVPWKTPAANDA
FT                   GKDTGNSSNTAAKVEKEPPAIPLDMLTGQDLDADYATFPIAWKRLQFRVATANNGRRKE
FT                   LQQHFVVRLRVVATLSTGMKTPICEVHSGPVIVRGRSPRNFQSRKDLPLSGSAAASRKN
FT                   AQAAAASNNLTRTSPSLTDKAKTVVKSSSPETSSNGVPQQSPPNWALATNSTLPPPTTT
FT                   TLPHSSVYSQSSPEFSRPVEAHRRTTSAIAAPINLSLLDDDSLNLSNGDSRPHTSFSND
FT                   LASKSLSVDSGRPVKMRKVSHSMPQAQSRSTSATFLNTANFQQMLPVPFTSESADVLYE
FT                   YFPLGLEDWQGPVDAVYRPHVVHHTNMPQMKYITARGQSKRYFAAEDSYSLVEAICPSG
FT                   WTYSRIISRTMI"
     MEGFDTMALP YLASPLSLGN MQGTDYLNAL QGMDLPDQRS NFDSETFVSG DDLTFAHLSP        60
     QTLKRFSSGY EDSFPEMVTS FDPPPPAEPP ADSSIDHNNK LLSFSMPVYP WTLLDYSFRR       120
     ASISISAQLH GMFFLAESPW TTSPTENAPP QQGAELTCYR RNLFQITGSV TLPRALRYII       180
     TDTGDRIPIV AHELTVSATE SVEGNSVKII SVPWKTPAAN DAGKDTGNSS NTAAKVEKEP       240
     PAIPLDMLTG QDLDADYATF PIAWKRLQFR VATANNGRRK ELQQHFVVRL RVVATLSTGM       300
     KTPICEVHSG PVIVRGRSPR NFQSRKDLPL SGSAAASRKN AQAAAASNNL TRTSPSLTDK       360
     AKTVVKSSSP ETSSNGVPQQ SPPNWALATN STLPPPTTTT LPHSSVYSQS SPEFSRPVEA       420
     HRRTTSAIAA PINLSLLDDD SLNLSNGDSR PHTSFSNDLA SKSLSVDSGR PVKMRKVSHS       480
     MPQAQSRSTS ATFLNTANFQ QMLPVPFTSE SADVLYEYFP LGLEDWQGPV DAVYRPHVVH       540
     HTNMPQMKYI TARGQSKRYF AAEDSYSLVE AICPSGWTYS RIISRTMI                    588
//

If you have problems or comments...

PBIL Back to PBIL home page