(data stored in ACNUC16935 zone)

EMBL: BN001307.PE24

BN001307.PE24        Location/Qualifiers
FT   CDS             complement(65984..67312)
FT                   /locus_tag="ANIA_09038"
FT                   /old_locus_tag="AN9038.4"
FT                   /product="molybdenum cofactor biosynthesis protein (MoeA),
FT                   putative (AFU_orthologue; AFUA_3G15170)"
FT                   /note="transcript_id=CADANIAT00007815"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007815"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007815"
FT                   /db_xref="GOA:Q5ARP2"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR005110"
FT                   /db_xref="InterPro:IPR005111"
FT                   /db_xref="InterPro:IPR036135"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036688"
FT                   /db_xref="InterPro:IPR038987"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARP2"
FT                   /protein_id="CBF84414.1"
FT                   /translation="MALSYADAVWLVKTEAQRHASLQRERCSIYSACDRVAAERITSPI
FT                   STPEYDTSAMDGFALSSTATETASPETPVTFNVMATTTAGDRPYPAADSLRDAKDSIPP
FT                   CVEIMTGAPFPTGQEWERFDCSVPIEEVVVQEDRCPPSQRRYVSVCKPARRWQHRRFAG
FT                   GDFTQGDRIIEAGDCIQPQHIMAMASVGLREIPVLRRPRIAVFSTGSELMSDASKAHQF
FT                   MIYDANGPYLTSILRQWGFDVVFRGVLQDDSAAMEESIVRALDYGYDMIVTSGAVSAGR
FT                   CDIIPGLVKRIGGRTVFHKVAVKPGHPILFAMLPPPRETGETAFFGLPGNTVAAAACLR
FT                   FFALPYLRTLQRQSPEEPKAAALRLSNGETEPCNGAAGKVLTFREAPDIFRPAISTQSG
FT                   QVWIIDDHSPGKTRPFLQANCWAHIPSGVSEMRAGSRVDIYPL"
     MALSYADAVW LVKTEAQRHA SLQRERCSIY SACDRVAAER ITSPISTPEY DTSAMDGFAL        60
     SSTATETASP ETPVTFNVMA TTTAGDRPYP AADSLRDAKD SIPPCVEIMT GAPFPTGQEW       120
     ERFDCSVPIE EVVVQEDRCP PSQRRYVSVC KPARRWQHRR FAGGDFTQGD RIIEAGDCIQ       180
     PQHIMAMASV GLREIPVLRR PRIAVFSTGS ELMSDASKAH QFMIYDANGP YLTSILRQWG       240
     FDVVFRGVLQ DDSAAMEESI VRALDYGYDM IVTSGAVSAG RCDIIPGLVK RIGGRTVFHK       300
     VAVKPGHPIL FAMLPPPRET GETAFFGLPG NTVAAAACLR FFALPYLRTL QRQSPEEPKA       360
     AALRLSNGET EPCNGAAGKV LTFREAPDIF RPAISTQSGQ VWIIDDHSPG KTRPFLQANC       420
     WAHIPSGVSE MRAGSRVDIY PL                                                442
//

If you have problems or comments...

PBIL Back to PBIL home page