(data stored in ACNUC16935 zone)

EMBL: BN001307.PE240

BN001307.PE240       Location/Qualifiers
FT   CDS             join(663947..664193,664393..664550)
FT                   /locus_tag="ANIA_01415"
FT                   /old_locus_tag="AN1415.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008026"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008026"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008026"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BDG5"
FT                   /protein_id="CBF84812.1"
FT                   /translation="MPQKDARRQWKRRMRRGLSLPEGPAALSDREKAALDPDKLVDHFS
FT                   FRGAKRGQALAKESQHSSILHLLHRQPTSAARFNLCRRFQRNSPEEPEGKLIRLTADGS
FT                   TPGDDPIGRLFLVPHSSQSLDGHSRLPGVH"
     MPQKDARRQW KRRMRRGLSL PEGPAALSDR EKAALDPDKL VDHFSFRGAK RGQALAKESQ        60
     HSSILHLLHR QPTSAARFNL CRRFQRNSPE EPEGKLIRLT ADGSTPGDDP IGRLFLVPHS       120
     SQSLDGHSRL PGVH                                                         134
//

If you have problems or comments...

PBIL Back to PBIL home page