(data stored in ACNUC16935 zone)

EMBL: BN001307.PE242

BN001307.PE242       Location/Qualifiers
FT   CDS             complement(join(670899..670935,671011..671145,
FT                   671176..671267,671345..671412,671502..671536,
FT                   671683..671984))
FT                   /locus_tag="ANIA_01417"
FT                   /old_locus_tag="AN1417.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008028"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008028"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008028"
FT                   /db_xref="GOA:Q5BDG3"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BDG3"
FT                   /protein_id="CBF84815.1"
FT                   /translation="MVNRPIDVVANSFVNPWLRCTRHPGSAFPVERDTTLSYYWLPALE
FT                   AHEARSFKIAGRDDDDTAECFFGPLKDHYWILSSPNCMTTHINTGLARMMRASLGICRW
FT                   DGTSARSHPQCNPGCEVVFAPSLMTDQQEVRTRDSGRVMLKLQADDNRATEVIFSRNRF
FT                   WILQRQSIRQWSKAVTKLTTFTETVNSVNGAWTEDSYQVVKLIGVRTRSSGANQLALWR
FT                   "
     MVNRPIDVVA NSFVNPWLRC TRHPGSAFPV ERDTTLSYYW LPALEAHEAR SFKIAGRDDD        60
     DTAECFFGPL KDHYWILSSP NCMTTHINTG LARMMRASLG ICRWDGTSAR SHPQCNPGCE       120
     VVFAPSLMTD QQEVRTRDSG RVMLKLQADD NRATEVIFSR NRFWILQRQS IRQWSKAVTK       180
     LTTFTETVNS VNGAWTEDSY QVVKLIGVRT RSSGANQLAL WR                          222
//

If you have problems or comments...

PBIL Back to PBIL home page