(data stored in ACNUC16935 zone)

EMBL: BN001307.PE244

BN001307.PE244       Location/Qualifiers
FT   CDS             join(673933..674082,674391..674417)
FT                   /locus_tag="ANIA_11301"
FT                   /old_locus_tag="AN11301.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008030"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008030"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008030"
FT                   /db_xref="GOA:C8VM32"
FT                   /db_xref="UniProtKB/TrEMBL:C8VM32"
FT                   /protein_id="CBF84819.1"
FT                   /translation="MDICSRVLRKRNQASRTAPADTVPVRVNDLQLQIVPLPRRTSRAQ
FT                   LTTSNKRRNFTTG"
     MDICSRVLRK RNQASRTAPA DTVPVRVNDL QLQIVPLPRR TSRAQLTTSN KRRNFTTG          58
//

If you have problems or comments...

PBIL Back to PBIL home page