(data stored in ACNUC16935 zone)

EMBL: BN001307.PE245

BN001307.PE245       Location/Qualifiers
FT   CDS             join(674812..674909,675083..675174,675513..675542,
FT                   675799..675977)
FT                   /locus_tag="ANIA_01419"
FT                   /old_locus_tag="AN1419.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008031"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008031"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008031"
FT                   /db_xref="GOA:Q5BDG1"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BDG1"
FT                   /protein_id="CBF84821.1"
FT                   /translation="MSRLLWMASDIQTQNEDACLGIHQLLPSTQCRASLSRVYFPVFKK
FT                   RENLTAHYQGAEAISILGRLREANIQKLDGDNNGSAIPTGAVMTKLLTLSSYGLDIVLF
FT                   QLEPRQHQSRISTDCGVRLINGKVAKSV"
     MSRLLWMASD IQTQNEDACL GIHQLLPSTQ CRASLSRVYF PVFKKRENLT AHYQGAEAIS        60
     ILGRLREANI QKLDGDNNGS AIPTGAVMTK LLTLSSYGLD IVLFQLEPRQ HQSRISTDCG       120
     VRLINGKVAK SV                                                           132
//

If you have problems or comments...

PBIL Back to PBIL home page