(data stored in ACNUC16935 zone)

EMBL: BN001307.PE246

BN001307.PE246       Location/Qualifiers
FT   CDS             complement(join(676771..678843,678905..679297))
FT                   /locus_tag="ANIA_01420"
FT                   /old_locus_tag="AN1420.4"
FT                   /product="Protein sip5
FT                   [Source:UniProtKB/Swiss-Prot;Acc:Q5BDG0]"
FT                   /note="transcript_id=CADANIAT00008032"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008032"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008032"
FT                   /db_xref="GOA:Q5BDG0"
FT                   /db_xref="InterPro:IPR039301"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5BDG0"
FT                   /protein_id="CBF84823.1"
FT                   /translation="MGNSQTKETRPSHSQSSRRSHQWGSGSSHGRSPYGDRHNSEGSRS
FT                   HRSSRPDLSILGLGGSSDRDVATILEHRRETKQEREARRLEKERAARIKERERSMREEH
FT                   VDGGYLVTQGVYTGTEDFNKAIVRQLMIERRLAPFWRGLNDFSDSWTEHQLMAAARGLP
FT                   IPPPDEIPPELEYRNPPKVVEEAKEASNIQSVQHLMVPITSRSASNGSDVSHSSQPAHS
FT                   LPSPSSPIASGTSSSPLFRSRAKTLASLTTSRHNSQVDSTPQEIQLPRDPFVNGQPIEA
FT                   YLYKDAIECPICFLYYPPYLNRTRCCDQPICSECFVQIKRPDPHPPEHADSDSNAPNPA
FT                   GETERQDVQDIQLVSEPAACPFCVQPEFGVAYVPPPFRRGLAYASDSSGRPNIGTPVSS
FT                   TSSLSSATTPTTGRRRATSLSATDPSVITTDKVRPDWAQKLANARAHAARRSAAATALH
FT                   TAAYLMNSNGSGGDTRGFSMRRGVMRRNNGGQDSPGTPGRSGSPALQAFAFLTDRRAPS
FT                   GQETDSAEEGTSNLAPPRNSSRRSRMDDLEEMMMMEAIRLSLASEEERRKREEKELRKE
FT                   AKRREKEAKKAEKMARKAGLYSNNASSSALESPSDSRLPKVTSSSSSIIGEERTPPGKG
FT                   KAVERVTPSQSNVDLTETASSGDVPSSFLEPQQPQSSSSLGPPVPKEPSKPSHLRHVSS
FT                   ASSSFSSLVESMSEEPGLSAQPHEGTSSSAEPLFNFRSLAAVIGDEDKSDEAAEHVEDT
FT                   APHTTSEGSTSSAANLTTAPAGESAVSTSSTAVEKGPTVEESQECSVNKEIETRSMEVT
FT                   DSRNSETTS"
     MGNSQTKETR PSHSQSSRRS HQWGSGSSHG RSPYGDRHNS EGSRSHRSSR PDLSILGLGG        60
     SSDRDVATIL EHRRETKQER EARRLEKERA ARIKERERSM REEHVDGGYL VTQGVYTGTE       120
     DFNKAIVRQL MIERRLAPFW RGLNDFSDSW TEHQLMAAAR GLPIPPPDEI PPELEYRNPP       180
     KVVEEAKEAS NIQSVQHLMV PITSRSASNG SDVSHSSQPA HSLPSPSSPI ASGTSSSPLF       240
     RSRAKTLASL TTSRHNSQVD STPQEIQLPR DPFVNGQPIE AYLYKDAIEC PICFLYYPPY       300
     LNRTRCCDQP ICSECFVQIK RPDPHPPEHA DSDSNAPNPA GETERQDVQD IQLVSEPAAC       360
     PFCVQPEFGV AYVPPPFRRG LAYASDSSGR PNIGTPVSST SSLSSATTPT TGRRRATSLS       420
     ATDPSVITTD KVRPDWAQKL ANARAHAARR SAAATALHTA AYLMNSNGSG GDTRGFSMRR       480
     GVMRRNNGGQ DSPGTPGRSG SPALQAFAFL TDRRAPSGQE TDSAEEGTSN LAPPRNSSRR       540
     SRMDDLEEMM MMEAIRLSLA SEEERRKREE KELRKEAKRR EKEAKKAEKM ARKAGLYSNN       600
     ASSSALESPS DSRLPKVTSS SSSIIGEERT PPGKGKAVER VTPSQSNVDL TETASSGDVP       660
     SSFLEPQQPQ SSSSLGPPVP KEPSKPSHLR HVSSASSSFS SLVESMSEEP GLSAQPHEGT       720
     SSSAEPLFNF RSLAAVIGDE DKSDEAAEHV EDTAPHTTSE GSTSSAANLT TAPAGESAVS       780
     TSSTAVEKGP TVEESQECSV NKEIETRSME VTDSRNSETT S                           821
//

If you have problems or comments...

PBIL Back to PBIL home page