(data stored in ACNUC16935 zone)

EMBL: BN001307.PE247

BN001307.PE247       Location/Qualifiers
FT   CDS             680504..682144
FT                   /locus_tag="ANIA_01421"
FT                   /old_locus_tag="AN1421.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008033"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008033"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008033"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BDF9"
FT                   /protein_id="CBF84825.1"
FT                   /translation="MTSESSATTRLHITPLNPELIPSVLPASVRSLASDISFHGIPTFP
FT                   ENNYGYVTLPKMEAEKLKKKLNGSILKGRKFKVEPARPQKRQAEEGDEQNFTSTDNPSV
FT                   TVKSKKRKAEENVLSGYELPSDRKVKRGWTESTTDKTERRKKEKRSKDKQEKKAKTQLK
FT                   SKYTEKPECLFRTKVPPNKSALAEEKSKKQPKKKKTSPESVVHEFAQTVTHPTFLRSED
FT                   GGNALICTFEEGKGWVDESGNLKEPASERVRKHQYRPGQIAGHKEKPKKIKVKSAPETD
FT                   SAKTSSSRNAEVKETESTESTESTESEDWTSSSGSSSESDITDSESDDTASSSLPESGE
FT                   SGNFELSSSRNEQQQAATHVSSEEEPEGSAKSGVLPKGNSTEATSQQGSTEVHPLEALF
FT                   KKPADQQKLDTEPPVQFSFFGQGDADSDAGFEEELSSNVAPLTPFTKRDLLDRGLRSAA
FT                   PTPDTSQVSKIINWNTPKISSNAVGEDYSFTDSPMPKSGTAATEESDFSKWFWENRGDN
FT                   NRAWKKRRRDAAKEQRQRENRRKGMKGKS"
     MTSESSATTR LHITPLNPEL IPSVLPASVR SLASDISFHG IPTFPENNYG YVTLPKMEAE        60
     KLKKKLNGSI LKGRKFKVEP ARPQKRQAEE GDEQNFTSTD NPSVTVKSKK RKAEENVLSG       120
     YELPSDRKVK RGWTESTTDK TERRKKEKRS KDKQEKKAKT QLKSKYTEKP ECLFRTKVPP       180
     NKSALAEEKS KKQPKKKKTS PESVVHEFAQ TVTHPTFLRS EDGGNALICT FEEGKGWVDE       240
     SGNLKEPASE RVRKHQYRPG QIAGHKEKPK KIKVKSAPET DSAKTSSSRN AEVKETESTE       300
     STESTESEDW TSSSGSSSES DITDSESDDT ASSSLPESGE SGNFELSSSR NEQQQAATHV       360
     SSEEEPEGSA KSGVLPKGNS TEATSQQGST EVHPLEALFK KPADQQKLDT EPPVQFSFFG       420
     QGDADSDAGF EEELSSNVAP LTPFTKRDLL DRGLRSAAPT PDTSQVSKII NWNTPKISSN       480
     AVGEDYSFTD SPMPKSGTAA TEESDFSKWF WENRGDNNRA WKKRRRDAAK EQRQRENRRK       540
     GMKGKS                                                                  546
//

If you have problems or comments...

PBIL Back to PBIL home page