(data stored in ACNUC16935 zone)

EMBL: BN001307.PE248

BN001307.PE248       Location/Qualifiers
FT   CDS             join(682460..682541,682613..682870,682946..683052,
FT                   683113..683166)
FT                   /locus_tag="ANIA_01422"
FT                   /old_locus_tag="AN1422.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008034"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008034"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008034"
FT                   /db_xref="GOA:Q5BDF8"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BDF8"
FT                   /protein_id="CBF84827.1"
FT                   /translation="MSRRNFIWHFLLLFIALLSFASSALASSPASFCKCTCFSNSTIIP
FT                   LDPDKGDSSLHGTLGLFSRNNYIDNQDEKRAGNYRSLSCNDCNRKFCLGYDLPTCKGAK
FT                   EDDVLTTCFQRDSRKDEAIVFIFIIATGGLLLWAVFRPWVQKWMEAARERRTYIPVSDS
FT                   PRL"
     MSRRNFIWHF LLLFIALLSF ASSALASSPA SFCKCTCFSN STIIPLDPDK GDSSLHGTLG        60
     LFSRNNYIDN QDEKRAGNYR SLSCNDCNRK FCLGYDLPTC KGAKEDDVLT TCFQRDSRKD       120
     EAIVFIFIIA TGGLLLWAVF RPWVQKWMEA ARERRTYIPV SDSPRL                      166
//

If you have problems or comments...

PBIL Back to PBIL home page