(data stored in ACNUC16935 zone)

EMBL: BN001307.PE250

BN001307.PE250       Location/Qualifiers
FT   CDS             686615..688777
FT                   /locus_tag="ANIA_01424"
FT                   /old_locus_tag="AN1424.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008036"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008036"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008036"
FT                   /db_xref="GOA:Q5BDF6"
FT                   /db_xref="InterPro:IPR024312"
FT                   /db_xref="InterPro:IPR039915"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BDF6"
FT                   /protein_id="CBF84830.1"
FT                   /translation="MNLSIRQSFGYHNDDFKTRDDQIGEEDALSFNDLQSSPFRPDGRD
FT                   DTVDMQMLQKYQTSHDMSGLSTTPRKRSYDQAPDVHDLERDEIERHKRSVGRKDIPDIN
FT                   IYVDEDSRISYDQSAHDVTKQDMENSNMKEKQHEGMSTVLNEEHEDISSRDQNDFDDDA
FT                   SAVMVDDETHDLMDDTCLSTFSAVPNVDMTAFANLPGGSPFKTPRPLPEFPAENKDTRR
FT                   GSMEPATPVTAKRSPSKNILLDMSSPAGLPTPGKRQRDDPTPSETPNLLDLTDSIDLFP
FT                   RRQRYIMQQQGRYSPSRRSPLRNPRSPAKTSLLDFDIPAAPTPRSIPTVTPRELESLKS
FT                   GFLSEISSLKATLSGKEAEVSSLKKAVSDAERRVGEALEEVRIEAARKETLEIEQAEWQ
FT                   RRGREMEDVLRSVRADILEGEQERERLQKKNEEAERGKEQLQRRIVELETQLSAAQKSA
FT                   VCEHTTSETAAPSKTAEETAKEIQDAVEKVARDLHSLYKEKHETKVAALKKSYEARWEK
FT                   RLREAEKKLKAANDECEQLKAERDAALQESARPDASMISRENEQHEAAKHVFEAQIAGL
FT                   QQEITILKSNSEQLRAELKAERAEKGDLVALVEEWLSMQNQQPAPSPQAKSHEVTPEPV
FT                   PNEQLTPTEDAEREVTRSSSSGLRGPSSGSVSTSSHGEKKIPRFGAPAGRHVRGTSGGK
FT                   SGIAVFTPGRSGIMGSIERMGRGGAA"
     MNLSIRQSFG YHNDDFKTRD DQIGEEDALS FNDLQSSPFR PDGRDDTVDM QMLQKYQTSH        60
     DMSGLSTTPR KRSYDQAPDV HDLERDEIER HKRSVGRKDI PDINIYVDED SRISYDQSAH       120
     DVTKQDMENS NMKEKQHEGM STVLNEEHED ISSRDQNDFD DDASAVMVDD ETHDLMDDTC       180
     LSTFSAVPNV DMTAFANLPG GSPFKTPRPL PEFPAENKDT RRGSMEPATP VTAKRSPSKN       240
     ILLDMSSPAG LPTPGKRQRD DPTPSETPNL LDLTDSIDLF PRRQRYIMQQ QGRYSPSRRS       300
     PLRNPRSPAK TSLLDFDIPA APTPRSIPTV TPRELESLKS GFLSEISSLK ATLSGKEAEV       360
     SSLKKAVSDA ERRVGEALEE VRIEAARKET LEIEQAEWQR RGREMEDVLR SVRADILEGE       420
     QERERLQKKN EEAERGKEQL QRRIVELETQ LSAAQKSAVC EHTTSETAAP SKTAEETAKE       480
     IQDAVEKVAR DLHSLYKEKH ETKVAALKKS YEARWEKRLR EAEKKLKAAN DECEQLKAER       540
     DAALQESARP DASMISRENE QHEAAKHVFE AQIAGLQQEI TILKSNSEQL RAELKAERAE       600
     KGDLVALVEE WLSMQNQQPA PSPQAKSHEV TPEPVPNEQL TPTEDAEREV TRSSSSGLRG       660
     PSSGSVSTSS HGEKKIPRFG APAGRHVRGT SGGKSGIAVF TPGRSGIMGS IERMGRGGAA       720
//

If you have problems or comments...

PBIL Back to PBIL home page